Gene Gene information from NCBI Gene database.
Entrez ID 7454
Gene name WASP actin nucleation promoting factor
Gene symbol WAS
Synonyms (NCBI Gene)
IMD2SCNXTHCTHC1WASPWASPA
Chromosome X
Chromosome location Xp11.23
Summary The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that the
SNPs SNP information provided by dbSNP.
64
SNP ID Visualize variation Clinical significance Consequence
rs132630268 G>A,C,T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs132630269 C>T Pathogenic Coding sequence variant, missense variant
rs132630270 C>G Pathogenic Coding sequence variant, missense variant
rs132630271 C>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs132630272 T>C Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
20
miRTarBase ID miRNA Experiments Reference
MIRT1488620 hsa-miR-1207-5p CLIP-seq
MIRT1488621 hsa-miR-1224-5p CLIP-seq
MIRT1488622 hsa-miR-1262 CLIP-seq
MIRT1488623 hsa-miR-1294 CLIP-seq
MIRT1488624 hsa-miR-3147 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
ETS1 Unknown 10066431
MYB Unknown 10066431
SP1 Unknown 10066431
SPI1 Unknown 10066431
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0002625 Process Regulation of T cell antigen processing and presentation IMP 22804504
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 8892607, 9405671, 9422512, 9660763, 10202051, 12029088, 12235133, 12591280, 15169891, 15361624, 16488394, 17213309, 17242350, 18650809, 19234535, 19487689, 19805221, 19817875, 20936779, 21516116, 21988832, 22252508, 25416956, 25502805, 29248492, 31515488, 32296183
GO:0005634 Component Nucleus IDA 20574068, 29925947
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300392 12731 ENSG00000015285
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P42768
Protein name Actin nucleation-promoting factor WAS (Wiskott-Aldrich syndrome protein) (WASp)
Protein function Effector protein for Rho-type GTPases that regulates actin filament reorganization via its interaction with the Arp2/3 complex (PubMed:12235133, PubMed:12769847, PubMed:16275905). Important for efficient actin polymerization (PubMed:12235133, Pu
PDB 1CEE , 1EJ5 , 1T84 , 2A3Z , 2K42 , 2OT0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1 36 145 WH1 domain Domain
PF00786 PBD 237 296 P21-Rho-binding domain Domain
PF02205 WH2 427 454 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the thymus. Also found, to a much lesser extent, in the spleen. {ECO:0000269|PubMed:8069912}.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKI
QKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIED
QGGL
EAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Sequence length 502
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Chemokine signaling pathway
Adherens junction
Tight junction
Fc gamma R-mediated phagocytosis
Yersinia infection
Choline metabolism in cancer
  Generation of second messenger molecules
Regulation of actin dynamics for phagocytic cup formation
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
14
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of blood and blood-forming tissues Likely pathogenic rs2147266958 RCV001814436
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colon adenocarcinoma Pathogenic rs1057517845 RCV005900671
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocytopenia Pathogenic; Likely pathogenic rs2147265894, rs2519289013, rs132630273 RCV002280913
RCV002280981
RCV000851684
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocytopenia 1 Likely pathogenic; Pathogenic rs2147262951, rs2147264299, rs2147264981, rs2147265693, rs2147265917, rs2147267350, rs2147262855, rs2147265717, rs2147266474, rs2147262809, rs2147263882, rs2147266379, rs2147263906, rs2147267240, rs2519281309
View all (78 more)
RCV001379030
RCV001387982
RCV001390444
RCV001386341
RCV001387588
View all (92 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormal bleeding Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUTROPENIA, SEVERE CONGENITAL, X-LINKED CTD, Disgenet, HPO
CTD, Disgenet, HPO
CTD, Disgenet, HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
X-LINKED THROMBOCYTOPENIA WITH NORMAL PLATELETS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute leukemia Leukemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anemia Hemolytic Autoimmune Autoimmune hemolytic anemia Pubtator 31354712 Associate
★☆☆☆☆
Found in Text Mining only
Anemia, Hemolytic Anemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anorexia Nervosa Anorexia BEFREE 30689342
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 26505163, 29423994, 29750976, 30115766, 31044291
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 29423994, 29750976, 30115766, 31044291
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 24945741, 25728049
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis HPO_DG
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 40048636 Associate
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 18043243, 20182458, 24369837, 24945741, 25728049, 26993433, 30410494, 31047647
★☆☆☆☆
Found in Text Mining only