VSNL1 (visinin like 1)

Gene

• Entrez ID: 7447
• Gene name: Visinin like 1
• Gene symbol: VSNL1
• Synonyms (NCBI Gene): HLP3, HPCAL3, HUVISL1, VILIP, VILIP-1
• Chromosome: 2
• Chromosome location: 2p24.2
• Summary: This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003036	hsa-miR-181b-5p	Luciferase assay/RT-PCR	18184693
MIRT003036	hsa-miR-181b-5p	Luciferase reporter assay	18184693
MIRT003036	hsa-miR-181b-5p	Reporter assay;Other	18184693
MIRT721306	hsa-miR-518e-3p	HITS-CLIP	19536157
MIRT721305	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT721304	hsa-miR-520g-5p	HITS-CLIP	19536157
MIRT721303	hsa-miR-5087	HITS-CLIP	19536157
MIRT721302	hsa-miR-8068	HITS-CLIP	19536157
MIRT721301	hsa-miR-587	HITS-CLIP	19536157
MIRT552906	hsa-miR-22-3p	HITS-CLIP	23824327
MIRT552905	hsa-miR-1257	HITS-CLIP	23824327
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT552903	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT607625	hsa-miR-3942-5p	HITS-CLIP	24906430
MIRT607624	hsa-miR-4703-5p	HITS-CLIP	24906430
MIRT607623	hsa-miR-16-2-3p	HITS-CLIP	24906430
MIRT607622	hsa-miR-195-3p	HITS-CLIP	24906430
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607621	hsa-miR-147a	HITS-CLIP	24906430
MIRT607620	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT552903	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT552906	hsa-miR-22-3p	PAR-CLIP	20371350
MIRT552905	hsa-miR-1257	PAR-CLIP	20371350
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	20371350
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT552903	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT552906	hsa-miR-22-3p	PAR-CLIP	21572407
MIRT552905	hsa-miR-1257	PAR-CLIP	21572407
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT552903	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT449356	hsa-miR-548n	PAR-CLIP	22100165
MIRT449354	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT449353	hsa-miR-548k	PAR-CLIP	22100165
MIRT449352	hsa-miR-8054	PAR-CLIP	22100165
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT449350	hsa-miR-3161	PAR-CLIP	22100165
MIRT449349	hsa-miR-599	PAR-CLIP	22100165
MIRT552905	hsa-miR-1257	HITS-CLIP	27418678
MIRT552905	hsa-miR-1257	HITS-CLIP	27418678
MIRT607621	hsa-miR-147a	HITS-CLIP	27418678
MIRT552906	hsa-miR-22-3p	HITS-CLIP	27418678
MIRT552906	hsa-miR-22-3p	HITS-CLIP	27418678
MIRT607620	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	27418678
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	27418678
MIRT552903	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT721306	hsa-miR-518e-3p	HITS-CLIP	19536157
MIRT721305	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT721304	hsa-miR-520g-5p	HITS-CLIP	19536157
MIRT721303	hsa-miR-5087	HITS-CLIP	19536157
MIRT721302	hsa-miR-8068	HITS-CLIP	19536157
MIRT721301	hsa-miR-587	HITS-CLIP	19536157
MIRT552906	hsa-miR-22-3p	HITS-CLIP	23824327
MIRT552905	hsa-miR-1257	HITS-CLIP	23824327
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT552903	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT552906	hsa-miR-22-3p	PAR-CLIP	20371350
MIRT552905	hsa-miR-1257	PAR-CLIP	20371350
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	20371350
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT552903	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT552906	hsa-miR-22-3p	PAR-CLIP	21572407
MIRT552905	hsa-miR-1257	PAR-CLIP	21572407
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT552903	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT449356	hsa-miR-548n	PAR-CLIP	22100165
MIRT449354	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT449353	hsa-miR-548k	PAR-CLIP	22100165
MIRT449352	hsa-miR-8054	PAR-CLIP	22100165
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT449350	hsa-miR-3161	PAR-CLIP	22100165
MIRT449349	hsa-miR-599	PAR-CLIP	22100165
MIRT1487861	hsa-miR-3064-3p	CLIP-seq
MIRT1487862	hsa-miR-4715-3p	CLIP-seq
MIRT1487863	hsa-miR-671-5p	CLIP-seq
MIRT2146805	hsa-miR-147	CLIP-seq
MIRT2146806	hsa-miR-3659	CLIP-seq
MIRT2146807	hsa-miR-4731-3p	CLIP-seq
MIRT2146808	hsa-miR-4801	CLIP-seq
MIRT2146809	hsa-miR-607	CLIP-seq
MIRT2146805	hsa-miR-147	CLIP-seq
MIRT2463337	hsa-miR-217	CLIP-seq
MIRT2463338	hsa-miR-4418	CLIP-seq
MIRT2463339	hsa-miR-509-3-5p	CLIP-seq
MIRT2463340	hsa-miR-509-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 25416956, 32296183, 32814053
GO:0005829	Component	Cytosol	IEA
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0045921	Process	Positive regulation of exocytosis	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 600817
• HGNC: 12722
• e!Ensembl: ENSG00000163032

Protein

• UniProt ID: P62760
• Protein name: Visinin-like protein 1 (VILIP) (VLP-1) (Hippocalcin-like protein 3) (HLP3)
• Protein function: Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00036	EF-hand_1	64 → 92	EF hand	Domain
  PF13499	EF-hand_7	98 → 176	EF-hand domain pair	Domain
  PF00036	EF-hand_1	100 → 128	EF hand	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level). {ECO:0000269|PubMed:18703769}.
• Sequence:

  MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
  ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
  MLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPS
  IVLLLQCDIQK

• Sequence length: 191

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30826210		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Acute transient psychotic disorder	Transient Psychotic Disorder	GWASCAT_DG	22005930		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	22331379		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35185794	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18703769, 36419075	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	26517091, 26769253, 30329219, 30846386	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30846386		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	22005930		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	22005930		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30311914, 30770953, 31771069		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24742816, 29241710		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37960721	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	18703769	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18301774		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18301774	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30826210		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	24598588, 28697565		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24598588	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22052372		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37096864, 37535601	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20079378		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	26517091	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29221444		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34302786	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	38203674	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	26769253		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26683098		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26683098, 32510239	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26683098		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	9109541		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20079378		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	35185794	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	BEFREE	25079293		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22832524, 24598588, 27018940, 28697565, 30311914		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30826210		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	26517091	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31051162		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18301774	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	23707265		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18301774		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22052372, 23707265		★☆☆☆☆ Found in Text Mining only
Medulloblastoma with extensive nodularity	Medulloblastoma With Extensive Nodularity	BEFREE	31781912		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28697565, 30207231, 30311914, 30630955		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18301774, 22052372		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	17615261		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36419075	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28623007		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18301774		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36216277	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	40420762	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31051162		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	25806004		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18184693, 22832524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18184693, 22832524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	19034380		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39836940	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21480386		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	21480386		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35595817	Associate	★☆☆☆☆ Found in Text Mining only