VPREB1 (V-set pre-B cell surrogate light chain 1)

Gene

• Entrez ID: 7441
• Gene name: V-set pre-B cell surrogate light chain 1
• Gene symbol: VPREB1
• Synonyms (NCBI Gene): CD179a, IGI, IGVPB, VPREB
• Chromosome: 22
• Chromosome location: 22q11.22
• Summary: The protein encoded by this gene belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. This gene encodes the iota polypeptide chain that is associated with t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030217	hsa-miR-26b-5p	Microarray	19088304
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT2146067	hsa-miR-4481	CLIP-seq
MIRT2146068	hsa-miR-4663	CLIP-seq
MIRT2146069	hsa-miR-4708-5p	CLIP-seq
MIRT2146070	hsa-miR-4728-3p	CLIP-seq
MIRT2146071	hsa-miR-4745-5p	CLIP-seq
MIRT2146072	hsa-miR-4758-5p	CLIP-seq
MIRT2659988	hsa-miR-626	CLIP-seq
MIRT2659988	hsa-miR-626	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006955	Process	Immune response	IBA
GO:0019814	Component	Immunoglobulin complex	IBA

Other IDs

• MIM: 605141
• HGNC: 12709
• e!Ensembl: ENSG00000169575

Protein

• UniProt ID: P12018
• Protein name: Immunoglobulin iota chain (CD179 antigen-like family member A) (Protein VPreB1) (V(pre)B protein) (VpreB protein) (CD antigen CD179a)
• Protein function: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
• PDB: 2H32, 2H3N, 3BJ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	24 → 132	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Only expressed by pre-B-cells.
• Sequence:

  MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR
  PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR
  SSEKEEREREWEEEMEPTAARTRVP

• Sequence length: 145

Pathways

Reactome:

Cell surface interactions at the vascular wall

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19138562, 27957801		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33101545	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21144590, 25523463		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1884024		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	1903358		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	26214592		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29859271		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29859271		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35260800	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35260800	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35260800	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27481583		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30244600		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22441210		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	1884024	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	1884024		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	21144590		★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	26214592		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1884018, 1884024	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1884024		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1884024	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12115231, 16126793	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12115231, 16126793		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	27957801		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33418558	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1903358		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1884024		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	11719380, 1903358, 20823132		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	26214592		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27957801		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21144590, 24602812		★☆☆☆☆ Found in Text Mining only