Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7434
Gene name	Vasoactive intestinal peptide receptor 2
Gene symbol	VIPR2
Synonyms (NCBI Gene)	C16DUPq36.3DUP7q36.3PACAP-R-3PACAP-R3VIP-R-2VPAC2VPAC2RVPCAP2R
Chromosome	7
Chromosome location	7q36.3
Summary	This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its act

196

Show/Hide all (196)

miRTarBase ID	miRNA	Experiments
MIRT1485013	hsa-miR-10a	CLIP-seq
MIRT1485014	hsa-miR-10b	CLIP-seq
MIRT1485015	hsa-miR-1271	CLIP-seq
MIRT1485016	hsa-miR-1285	CLIP-seq
MIRT1485017	hsa-miR-1286	CLIP-seq
MIRT1485018	hsa-miR-1909	CLIP-seq
MIRT1485019	hsa-miR-1915	CLIP-seq
MIRT1485020	hsa-miR-3158-3p	CLIP-seq
MIRT1485021	hsa-miR-3187-5p	CLIP-seq
MIRT1485022	hsa-miR-320a	CLIP-seq
MIRT1485023	hsa-miR-320b	CLIP-seq
MIRT1485024	hsa-miR-320c	CLIP-seq
MIRT1485025	hsa-miR-320d	CLIP-seq
MIRT1485026	hsa-miR-320e	CLIP-seq
MIRT1485027	hsa-miR-326	CLIP-seq
MIRT1485028	hsa-miR-330-5p	CLIP-seq
MIRT1485029	hsa-miR-339-5p	CLIP-seq
MIRT1485030	hsa-miR-378	CLIP-seq
MIRT1485031	hsa-miR-378b	CLIP-seq
MIRT1485032	hsa-miR-378c	CLIP-seq
MIRT1485033	hsa-miR-378d	CLIP-seq
MIRT1485034	hsa-miR-378e	CLIP-seq
MIRT1485035	hsa-miR-378f	CLIP-seq
MIRT1485036	hsa-miR-378h	CLIP-seq
MIRT1485037	hsa-miR-378i	CLIP-seq
MIRT1485038	hsa-miR-3941	CLIP-seq
MIRT1485039	hsa-miR-3944-5p	CLIP-seq
MIRT1485040	hsa-miR-422a	CLIP-seq
MIRT1485041	hsa-miR-4258	CLIP-seq
MIRT1485042	hsa-miR-4261	CLIP-seq
MIRT1485043	hsa-miR-4270	CLIP-seq
MIRT1485044	hsa-miR-4327	CLIP-seq
MIRT1485045	hsa-miR-4421	CLIP-seq
MIRT1485046	hsa-miR-4429	CLIP-seq
MIRT1485047	hsa-miR-4436a	CLIP-seq
MIRT1485048	hsa-miR-4441	CLIP-seq
MIRT1485049	hsa-miR-4455	CLIP-seq
MIRT1485050	hsa-miR-4466	CLIP-seq
MIRT1485051	hsa-miR-4468	CLIP-seq
MIRT1485052	hsa-miR-4496	CLIP-seq
MIRT1485053	hsa-miR-4505	CLIP-seq
MIRT1485054	hsa-miR-4638-3p	CLIP-seq
MIRT1485055	hsa-miR-4643	CLIP-seq
MIRT1485056	hsa-miR-4651	CLIP-seq
MIRT1485057	hsa-miR-466	CLIP-seq
MIRT1485058	hsa-miR-4672	CLIP-seq
MIRT1485059	hsa-miR-4684-5p	CLIP-seq
MIRT1485060	hsa-miR-4685-5p	CLIP-seq
MIRT1485061	hsa-miR-4708-3p	CLIP-seq
MIRT1485062	hsa-miR-4717-3p	CLIP-seq
MIRT1485063	hsa-miR-4722-5p	CLIP-seq
MIRT1485064	hsa-miR-4731-5p	CLIP-seq
MIRT1485065	hsa-miR-4749-3p	CLIP-seq
MIRT1485066	hsa-miR-4754	CLIP-seq
MIRT1485067	hsa-miR-4756-3p	CLIP-seq
MIRT1485068	hsa-miR-4793-5p	CLIP-seq
MIRT1485069	hsa-miR-4794	CLIP-seq
MIRT1485070	hsa-miR-4802-3p	CLIP-seq
MIRT1485071	hsa-miR-488	CLIP-seq
MIRT1485072	hsa-miR-548c-3p	CLIP-seq
MIRT1485073	hsa-miR-593	CLIP-seq
MIRT1485074	hsa-miR-608	CLIP-seq
MIRT1485075	hsa-miR-612	CLIP-seq
MIRT1485076	hsa-miR-637	CLIP-seq
MIRT1485077	hsa-miR-675	CLIP-seq
MIRT1485078	hsa-miR-873	CLIP-seq
MIRT1485079	hsa-miR-96	CLIP-seq
MIRT2145923	hsa-miR-24	CLIP-seq
MIRT2145924	hsa-miR-3178	CLIP-seq
MIRT1485027	hsa-miR-326	CLIP-seq
MIRT1485028	hsa-miR-330-5p	CLIP-seq
MIRT1485029	hsa-miR-339-5p	CLIP-seq
MIRT2145925	hsa-miR-3689a-3p	CLIP-seq
MIRT2145926	hsa-miR-3689c	CLIP-seq
MIRT2145927	hsa-miR-4437	CLIP-seq
MIRT2145928	hsa-miR-4474-3p	CLIP-seq
MIRT2145929	hsa-miR-450b-5p	CLIP-seq
MIRT2145930	hsa-miR-4728-5p	CLIP-seq
MIRT2145931	hsa-miR-494	CLIP-seq
MIRT2145932	hsa-miR-507	CLIP-seq
MIRT2145933	hsa-miR-541	CLIP-seq
MIRT2145934	hsa-miR-557	CLIP-seq
MIRT2145935	hsa-miR-604	CLIP-seq
MIRT2145936	hsa-miR-647	CLIP-seq
MIRT2145937	hsa-miR-654-5p	CLIP-seq
MIRT2145938	hsa-miR-765	CLIP-seq
MIRT2366337	hsa-miR-1267	CLIP-seq
MIRT2366338	hsa-miR-1273	CLIP-seq
MIRT2366339	hsa-miR-1976	CLIP-seq
MIRT2145923	hsa-miR-24	CLIP-seq
MIRT2366340	hsa-miR-3122	CLIP-seq
MIRT2366341	hsa-miR-3175	CLIP-seq
MIRT2145925	hsa-miR-3689a-3p	CLIP-seq
MIRT2145926	hsa-miR-3689c	CLIP-seq
MIRT2366342	hsa-miR-3913-5p	CLIP-seq
MIRT2366343	hsa-miR-4252	CLIP-seq
MIRT2366344	hsa-miR-4279	CLIP-seq
MIRT2366345	hsa-miR-4284	CLIP-seq
MIRT2366346	hsa-miR-4418	CLIP-seq
MIRT2366347	hsa-miR-4486	CLIP-seq
MIRT2366348	hsa-miR-455-3p	CLIP-seq
MIRT2366349	hsa-miR-4649-5p	CLIP-seq
MIRT2366350	hsa-miR-4717-5p	CLIP-seq
MIRT1485063	hsa-miR-4722-5p	CLIP-seq
MIRT2145930	hsa-miR-4728-5p	CLIP-seq
MIRT2366351	hsa-miR-4798-3p	CLIP-seq
MIRT2366352	hsa-miR-509-3-5p	CLIP-seq
MIRT2366353	hsa-miR-509-5p	CLIP-seq
MIRT2366354	hsa-miR-661	CLIP-seq
MIRT1485013	hsa-miR-10a	CLIP-seq
MIRT1485014	hsa-miR-10b	CLIP-seq
MIRT2463182	hsa-miR-3150a-5p	CLIP-seq
MIRT2463183	hsa-miR-3150b-5p	CLIP-seq
MIRT1485029	hsa-miR-339-5p	CLIP-seq
MIRT2463184	hsa-miR-3613-3p	CLIP-seq
MIRT2463185	hsa-miR-3681	CLIP-seq
MIRT2463186	hsa-miR-371-5p	CLIP-seq
MIRT2463187	hsa-miR-371b-5p	CLIP-seq
MIRT1485045	hsa-miR-4421	CLIP-seq
MIRT2463188	hsa-miR-4662a-5p	CLIP-seq
MIRT2463189	hsa-miR-4676-5p	CLIP-seq
MIRT1485059	hsa-miR-4684-5p	CLIP-seq
MIRT2463190	hsa-miR-4755-3p	CLIP-seq
MIRT2463191	hsa-miR-4786-5p	CLIP-seq
MIRT1485068	hsa-miR-4793-5p	CLIP-seq
MIRT1485069	hsa-miR-4794	CLIP-seq
MIRT2463192	hsa-miR-4796-3p	CLIP-seq
MIRT1485072	hsa-miR-548c-3p	CLIP-seq
MIRT2463193	hsa-miR-548t	CLIP-seq
MIRT2463194	hsa-miR-575	CLIP-seq
MIRT1485073	hsa-miR-593	CLIP-seq
MIRT1485013	hsa-miR-10a	CLIP-seq
MIRT1485014	hsa-miR-10b	CLIP-seq
MIRT1485029	hsa-miR-339-5p	CLIP-seq
MIRT2463184	hsa-miR-3613-3p	CLIP-seq
MIRT1485045	hsa-miR-4421	CLIP-seq
MIRT2463188	hsa-miR-4662a-5p	CLIP-seq
MIRT2463189	hsa-miR-4676-5p	CLIP-seq
MIRT1485059	hsa-miR-4684-5p	CLIP-seq
MIRT2463190	hsa-miR-4755-3p	CLIP-seq
MIRT1485072	hsa-miR-548c-3p	CLIP-seq
MIRT2463194	hsa-miR-575	CLIP-seq
MIRT1485073	hsa-miR-593	CLIP-seq
MIRT1485013	hsa-miR-10a	CLIP-seq
MIRT1485014	hsa-miR-10b	CLIP-seq
MIRT2366338	hsa-miR-1273	CLIP-seq
MIRT2659892	hsa-miR-1908	CLIP-seq
MIRT2366340	hsa-miR-3122	CLIP-seq
MIRT1485029	hsa-miR-339-5p	CLIP-seq
MIRT2463184	hsa-miR-3613-3p	CLIP-seq
MIRT2145925	hsa-miR-3689a-3p	CLIP-seq
MIRT2145926	hsa-miR-3689c	CLIP-seq
MIRT2366342	hsa-miR-3913-5p	CLIP-seq
MIRT1485045	hsa-miR-4421	CLIP-seq
MIRT2366347	hsa-miR-4486	CLIP-seq
MIRT2366348	hsa-miR-455-3p	CLIP-seq
MIRT2366349	hsa-miR-4649-5p	CLIP-seq
MIRT2463188	hsa-miR-4662a-5p	CLIP-seq
MIRT2463189	hsa-miR-4676-5p	CLIP-seq
MIRT1485059	hsa-miR-4684-5p	CLIP-seq
MIRT2145930	hsa-miR-4728-5p	CLIP-seq
MIRT2659893	hsa-miR-4730	CLIP-seq
MIRT2463190	hsa-miR-4755-3p	CLIP-seq
MIRT2659894	hsa-miR-4767	CLIP-seq
MIRT2463191	hsa-miR-4786-5p	CLIP-seq
MIRT1485068	hsa-miR-4793-5p	CLIP-seq
MIRT1485069	hsa-miR-4794	CLIP-seq
MIRT1485072	hsa-miR-548c-3p	CLIP-seq
MIRT2463194	hsa-miR-575	CLIP-seq
MIRT1485073	hsa-miR-593	CLIP-seq
MIRT2366354	hsa-miR-661	CLIP-seq
MIRT2659895	hsa-miR-663	CLIP-seq
MIRT1485013	hsa-miR-10a	CLIP-seq
MIRT1485014	hsa-miR-10b	CLIP-seq
MIRT2659892	hsa-miR-1908	CLIP-seq
MIRT2366340	hsa-miR-3122	CLIP-seq
MIRT1485029	hsa-miR-339-5p	CLIP-seq
MIRT2463184	hsa-miR-3613-3p	CLIP-seq
MIRT2145925	hsa-miR-3689a-3p	CLIP-seq
MIRT2145926	hsa-miR-3689c	CLIP-seq
MIRT2366342	hsa-miR-3913-5p	CLIP-seq
MIRT1485045	hsa-miR-4421	CLIP-seq
MIRT2463188	hsa-miR-4662a-5p	CLIP-seq
MIRT2463189	hsa-miR-4676-5p	CLIP-seq
MIRT1485059	hsa-miR-4684-5p	CLIP-seq
MIRT2145930	hsa-miR-4728-5p	CLIP-seq
MIRT2659893	hsa-miR-4730	CLIP-seq
MIRT2463190	hsa-miR-4755-3p	CLIP-seq
MIRT2659894	hsa-miR-4767	CLIP-seq
MIRT2463191	hsa-miR-4786-5p	CLIP-seq
MIRT1485068	hsa-miR-4793-5p	CLIP-seq
MIRT1485069	hsa-miR-4794	CLIP-seq
MIRT1485072	hsa-miR-548c-3p	CLIP-seq
MIRT2463194	hsa-miR-575	CLIP-seq
MIRT1485073	hsa-miR-593	CLIP-seq
MIRT2659895	hsa-miR-663	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001634	Function	Pituitary adenylate cyclase-activating polypeptide receptor activity	IMP	35477937
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	7811244
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	IBA
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	IDA	8933357
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	35477937
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7811244
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7811244
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8933357, 35477937
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	35477937
GO:0007267	Process	Cell-cell signaling	TAS	8757618
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA

MIM	HGNC	e!Ensembl
601970	12695	ENSG00000106018

P41587

Protein name

Vasoactive intestinal polypeptide receptor 2 (VIP-R-2) (Helodermin-preferring VIP receptor) (Pituitary adenylate cyclase-activating polypeptide type III receptor) (PACAP type III receptor) (PACAP-R-3) (PACAP-R3) (VPAC2 receptor) (VPAC2R)

Protein function

G protein-coupled receptor activated by the neuropeptides vasoactive intestinal peptide (VIP) and pituitary adenylate cyclase-activating polypeptide (ADCYAP1/PACAP) (PubMed:7811244, PubMed:35477937, PubMed:8933357). Binds VIP and both PACAP27 an

PDB

2X57 , 7VQX , 7WBJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	49 → 112	Hormone receptor domain	Family
PF00002	7tm_2	123 → 371	7 transmembrane receptor (Secretin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in CD4+ T-cells, but not in CD8+ T-cells. Expressed in the T-cell lines Jurkat, Peer, MOLT-4, HSB, YT and SUP-T1, but not in the T-cell lines HARRIS and HuT 78. {ECO:0000269|PubMed:8926282}.

Sequence

MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNIT
CWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKI
TFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKD
DVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRC
FLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFE
LCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ
FHRGSRAQSFLQTETSVI

Sequence length

438

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (73)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12573802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21711977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	18383383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18383383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25430993	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26881970	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26304033, 32066674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30067938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	11392521, 27796743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31089161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20072116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Diseases	Brain disease	Pubtator	29484035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17683807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	15572539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11193832, 12732341, 21769421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34887858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30466987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	29484035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	24827637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30466987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32599859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	27891695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18383383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12743576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	30466987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12743576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34329340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	16552823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35456975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	32747757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HOLOPROSENCEPHALY 3	Holoprosencephaly	BEFREE	8938447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17478887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30466987, 32227373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30025111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29526016, 31444475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	30466987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	29063609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30390393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29270240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20072116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17683807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11193832, 12732341, 21769421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22763881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17683807, 22763881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30466987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28296937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20974589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20072116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17077178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17077178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39201536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	23406873, 31796800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	23637909, 31796800, 38222453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	GWASCAT_DG	23406873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10188714, 21769421, 29063609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19269029		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30022438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28207535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26674871, 27891695, 31619964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27891695	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	24827637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12573802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	BEFREE	12573802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	24220567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22763881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	37695605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21285140, 21346763, 21721910, 23073313, 24002029, 24220567, 24794882, 27156032, 30077368		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	21285140		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21285140	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe myopia	Myopia	BEFREE	23406873, 23637909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24827637	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26406417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24827637		★★★★★ ★☆☆☆☆ Found in Text Mining only

VIPR2 (vasoactive intestinal peptide receptor 2)