Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7433
Gene name	Vasoactive intestinal peptide receptor 1
Gene symbol	VIPR1
Synonyms (NCBI Gene)	HVR1IIPACAP-R-2PACAP-R2RDC1V1RGVAPC1VIP-R-1VIPRVIRGVPAC1VPAC1RVPCAP1R
Chromosome	3
Chromosome location	3p22.1
Summary	This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its act

329

Show/Hide all (329)

miRTarBase ID	miRNA	Experiments	Reference
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609738	hsa-miR-4513	HITS-CLIP	23824327
MIRT609737	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609738	hsa-miR-4513	HITS-CLIP	23824327
MIRT609737	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	28735896
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	28735896
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	28735896
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	28735896
MIRT609736	hsa-miR-1260a	HITS-CLIP	28735896
MIRT609736	hsa-miR-1260a	HITS-CLIP	28735896
MIRT609736	hsa-miR-1260a	HITS-CLIP	28735896
MIRT609736	hsa-miR-1260a	HITS-CLIP	28735896
MIRT609735	hsa-miR-1260b	HITS-CLIP	28735896
MIRT609735	hsa-miR-1260b	HITS-CLIP	28735896
MIRT609735	hsa-miR-1260b	HITS-CLIP	28735896
MIRT609735	hsa-miR-1260b	HITS-CLIP	28735896
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	28735896
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	28735896
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	28735896
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	28735896
MIRT609741	hsa-miR-4494	HITS-CLIP	28735896
MIRT609741	hsa-miR-4494	HITS-CLIP	28735896
MIRT609741	hsa-miR-4494	HITS-CLIP	28735896
MIRT609741	hsa-miR-4494	HITS-CLIP	28735896
MIRT609742	hsa-miR-4499	HITS-CLIP	28735896
MIRT609742	hsa-miR-4499	HITS-CLIP	28735896
MIRT609742	hsa-miR-4499	HITS-CLIP	28735896
MIRT609742	hsa-miR-4499	HITS-CLIP	28735896
MIRT609731	hsa-miR-4507	HITS-CLIP	28735896
MIRT609731	hsa-miR-4507	HITS-CLIP	28735896
MIRT609731	hsa-miR-4507	HITS-CLIP	28735896
MIRT609731	hsa-miR-4507	HITS-CLIP	28735896
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	28735896
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	28735896
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	28735896
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	28735896
MIRT609739	hsa-miR-532-3p	HITS-CLIP	28735896
MIRT609739	hsa-miR-532-3p	HITS-CLIP	28735896
MIRT609739	hsa-miR-532-3p	HITS-CLIP	28735896
MIRT609739	hsa-miR-532-3p	HITS-CLIP	28735896
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	28735896
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	28735896
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	28735896
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	28735896
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609738	hsa-miR-4513	HITS-CLIP	23824327
MIRT609737	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT609742	hsa-miR-4499	HITS-CLIP	23824327
MIRT609741	hsa-miR-4494	HITS-CLIP	23824327
MIRT609740	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT609739	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT609738	hsa-miR-4513	HITS-CLIP	23824327
MIRT609737	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT609736	hsa-miR-1260a	HITS-CLIP	23824327
MIRT609735	hsa-miR-1260b	HITS-CLIP	23824327
MIRT609734	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT609733	hsa-miR-500a-3p	HITS-CLIP	23824327
MIRT609732	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT609731	hsa-miR-4507	HITS-CLIP	23824327
MIRT1484980	hsa-miR-1245b-3p	CLIP-seq
MIRT1484981	hsa-miR-1260	CLIP-seq
MIRT1484982	hsa-miR-1280	CLIP-seq
MIRT1484983	hsa-miR-1324	CLIP-seq
MIRT1484984	hsa-miR-2467-3p	CLIP-seq
MIRT1484985	hsa-miR-3128	CLIP-seq
MIRT1484986	hsa-miR-3132	CLIP-seq
MIRT1484987	hsa-miR-3166	CLIP-seq
MIRT1484988	hsa-miR-3179	CLIP-seq
MIRT1484989	hsa-miR-3182	CLIP-seq
MIRT1484990	hsa-miR-3184	CLIP-seq
MIRT1484991	hsa-miR-342-5p	CLIP-seq
MIRT1484992	hsa-miR-3672	CLIP-seq
MIRT1484993	hsa-miR-423-5p	CLIP-seq
MIRT1484994	hsa-miR-4252	CLIP-seq
MIRT1484995	hsa-miR-4257	CLIP-seq
MIRT1484996	hsa-miR-432	CLIP-seq
MIRT1484997	hsa-miR-4329	CLIP-seq
MIRT1484998	hsa-miR-4436b-3p	CLIP-seq
MIRT1484999	hsa-miR-4476	CLIP-seq
MIRT1485000	hsa-miR-4481	CLIP-seq
MIRT1485001	hsa-miR-4651	CLIP-seq
MIRT1485002	hsa-miR-4664-5p	CLIP-seq
MIRT1485003	hsa-miR-4684-3p	CLIP-seq
MIRT1485004	hsa-miR-4695-5p	CLIP-seq
MIRT1485005	hsa-miR-4720-5p	CLIP-seq
MIRT1485006	hsa-miR-4729	CLIP-seq
MIRT1485007	hsa-miR-4745-5p	CLIP-seq
MIRT1485008	hsa-miR-4758-5p	CLIP-seq
MIRT1485009	hsa-miR-4786-3p	CLIP-seq
MIRT1485010	hsa-miR-4799-3p	CLIP-seq
MIRT1485011	hsa-miR-608	CLIP-seq
MIRT1485012	hsa-miR-890	CLIP-seq
MIRT1484981	hsa-miR-1260	CLIP-seq
MIRT1484982	hsa-miR-1280	CLIP-seq
MIRT1484981	hsa-miR-1260	CLIP-seq
MIRT1484982	hsa-miR-1280	CLIP-seq
MIRT1484981	hsa-miR-1260	CLIP-seq
MIRT1484982	hsa-miR-1280	CLIP-seq
MIRT1484983	hsa-miR-1324	CLIP-seq
MIRT2145913	hsa-miR-2277-3p	CLIP-seq
MIRT2145914	hsa-miR-3120-3p	CLIP-seq
MIRT1484987	hsa-miR-3166	CLIP-seq
MIRT1484988	hsa-miR-3179	CLIP-seq
MIRT2145915	hsa-miR-3180	CLIP-seq
MIRT2145916	hsa-miR-3180-3p	CLIP-seq
MIRT2145917	hsa-miR-3196	CLIP-seq
MIRT2145918	hsa-miR-3202	CLIP-seq
MIRT1484991	hsa-miR-342-5p	CLIP-seq
MIRT2145919	hsa-miR-3908	CLIP-seq
MIRT2145920	hsa-miR-4264	CLIP-seq
MIRT1484998	hsa-miR-4436b-3p	CLIP-seq
MIRT1485000	hsa-miR-4481	CLIP-seq
MIRT1485001	hsa-miR-4651	CLIP-seq
MIRT1485002	hsa-miR-4664-5p	CLIP-seq
MIRT1485003	hsa-miR-4684-3p	CLIP-seq
MIRT2145921	hsa-miR-4728-5p	CLIP-seq
MIRT1485006	hsa-miR-4729	CLIP-seq
MIRT1485007	hsa-miR-4745-5p	CLIP-seq
MIRT2145922	hsa-miR-4747-5p	CLIP-seq
MIRT1485008	hsa-miR-4758-5p	CLIP-seq
MIRT1485011	hsa-miR-608	CLIP-seq
MIRT2366329	hsa-miR-1256	CLIP-seq
MIRT2366330	hsa-miR-138	CLIP-seq
MIRT2366331	hsa-miR-2115	CLIP-seq
MIRT1484985	hsa-miR-3128	CLIP-seq
MIRT2366332	hsa-miR-3160-5p	CLIP-seq
MIRT1484989	hsa-miR-3182	CLIP-seq
MIRT2366333	hsa-miR-3692	CLIP-seq
MIRT2366334	hsa-miR-369-3p	CLIP-seq
MIRT2366335	hsa-miR-3977	CLIP-seq
MIRT1485000	hsa-miR-4481	CLIP-seq
MIRT1485005	hsa-miR-4720-5p	CLIP-seq
MIRT1485007	hsa-miR-4745-5p	CLIP-seq
MIRT1485008	hsa-miR-4758-5p	CLIP-seq
MIRT1485010	hsa-miR-4799-3p	CLIP-seq
MIRT2366336	hsa-miR-516a-3p	CLIP-seq
MIRT1484981	hsa-miR-1260	CLIP-seq
MIRT1484982	hsa-miR-1280	CLIP-seq
MIRT2463173	hsa-miR-1321	CLIP-seq
MIRT2463174	hsa-miR-3157-5p	CLIP-seq
MIRT2463175	hsa-miR-4270	CLIP-seq
MIRT2463176	hsa-miR-4441	CLIP-seq
MIRT2463177	hsa-miR-4685-5p	CLIP-seq
MIRT2463178	hsa-miR-4691-3p	CLIP-seq
MIRT2145921	hsa-miR-4728-5p	CLIP-seq
MIRT2463179	hsa-miR-4739	CLIP-seq
MIRT2463180	hsa-miR-4756-5p	CLIP-seq
MIRT2463181	hsa-miR-508-5p	CLIP-seq
MIRT2463173	hsa-miR-1321	CLIP-seq
MIRT2463174	hsa-miR-3157-5p	CLIP-seq
MIRT2463175	hsa-miR-4270	CLIP-seq
MIRT2463176	hsa-miR-4441	CLIP-seq
MIRT2463177	hsa-miR-4685-5p	CLIP-seq
MIRT2463178	hsa-miR-4691-3p	CLIP-seq
MIRT2145921	hsa-miR-4728-5p	CLIP-seq
MIRT2463179	hsa-miR-4739	CLIP-seq
MIRT2463180	hsa-miR-4756-5p	CLIP-seq
MIRT2463181	hsa-miR-508-5p	CLIP-seq
MIRT2463173	hsa-miR-1321	CLIP-seq
MIRT2463174	hsa-miR-3157-5p	CLIP-seq
MIRT2463175	hsa-miR-4270	CLIP-seq
MIRT2463176	hsa-miR-4441	CLIP-seq
MIRT2463177	hsa-miR-4685-5p	CLIP-seq
MIRT2463178	hsa-miR-4691-3p	CLIP-seq
MIRT2145921	hsa-miR-4728-5p	CLIP-seq
MIRT2463179	hsa-miR-4739	CLIP-seq
MIRT2463180	hsa-miR-4756-5p	CLIP-seq
MIRT2463181	hsa-miR-508-5p	CLIP-seq
MIRT2695016	hsa-miR-1273d	CLIP-seq
MIRT2463173	hsa-miR-1321	CLIP-seq
MIRT2695017	hsa-miR-155	CLIP-seq
MIRT2463174	hsa-miR-3157-5p	CLIP-seq
MIRT2463175	hsa-miR-4270	CLIP-seq
MIRT2463176	hsa-miR-4441	CLIP-seq
MIRT2463177	hsa-miR-4685-5p	CLIP-seq
MIRT2463178	hsa-miR-4691-3p	CLIP-seq
MIRT2695018	hsa-miR-4720-3p	CLIP-seq
MIRT2145921	hsa-miR-4728-5p	CLIP-seq
MIRT2463179	hsa-miR-4739	CLIP-seq
MIRT2463180	hsa-miR-4756-5p	CLIP-seq
MIRT2695019	hsa-miR-4804-3p	CLIP-seq
MIRT2463181	hsa-miR-508-5p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001634	Function	Pituitary adenylate cyclase-activating polypeptide receptor activity	IDA	36385145
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	IBA
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	IDA	8390245, 36385145
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	IEA
GO:0004999	Function	Vasoactive intestinal polypeptide receptor activity	TAS	8179610
GO:0005515	Function	Protein binding	IPI	23597562, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8179610
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8179610
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8179610
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	8390245
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	36385145
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8389448
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0017046	Function	Peptide hormone binding	IPI	8390245
GO:0043235	Component	Receptor complex	IDA	23382219

MIM	HGNC	e!Ensembl
192321	12694	ENSG00000114812

P32241

Protein name

Vasoactive intestinal polypeptide receptor 1 (VIP-R-1) (Pituitary adenylate cyclase-activating polypeptide type II receptor) (PACAP type II receptor) (PACAP-R-2) (PACAP-R2) (VPAC1 receptor) (VPAC1R)

Protein function

G protein-coupled receptor activated by the neuropeptides vasoactive intestinal peptide (VIP) and pituitary adenylate cyclase-activating polypeptide (ADCYAP1/PACAP) (PubMed:35477937, PubMed:36385145, PubMed:8179610). Binds VIP and both PACAP27 a

PDB

1OF2 , 1OGT , 3B3I , 3B6S , 3DTX , 3HCV , 5DEF , 5DEG , 5IB1 , 5IB2 , 5IB3 , 5IB4 , 5IB5 , 6VN7 , 7ALO , 8E3Y , 8E3Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	60 → 125	Hormone receptor domain	Family
PF00002	7tm_2	139 → 384	7 transmembrane receptor (Secretin family)	Family

Tissue specificity

TISSUE SPECIFICITY: In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in

Sequence

MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET
IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPI
ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH
LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL
YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP
ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF
PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH
PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV

Sequence length

457

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ACHALASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (92)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	18663606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23707988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20014941, 31560089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12573802, 20483910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21711977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25390694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	18668120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	26881970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10555038, 26881970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25430993	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31089161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	27346196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	20008985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28577428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11165054, 11193846, 12088760, 16888206, 17683807, 20008985, 21896307, 22199290, 30810849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17727979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	15572539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	20026142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34424809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35864952, 36038907	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11193832, 12409225, 12732341, 17942192, 21769421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	20922191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	20922191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20026142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10879736, 12094871, 9620342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30407703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10769164, 24671823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23365656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10769164, 24671823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	12118328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	27891695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17611633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	17314160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22166542, 26712708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17401158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	20922191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Achalasia	Esophageal achalasia	Pubtator	20922191	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	20922191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15943629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	20922191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	20922191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28385693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	30692637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31292914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31292914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	32747757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	10548340, 14962225, 9186827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	27346196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	10548340, 14962225, 9186827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	15484277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic achalasia of esophagus	Idiopathic achalasia	BEFREE	19309439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17611633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28385693, 30407703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33797165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	24562426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11431747, 12210407, 21123377, 21778049, 30390393, 30583864, 31258761, 8760588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10440804, 10879736, 12094871, 9620342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	15943629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21123377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11193832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17802906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17802906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	17802906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	17802906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11193846, 12088760, 14706566, 16888206, 17683807, 20008985, 21896307, 22199290, 30810849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11193832, 12409225, 12732341, 17942192, 21769421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22763881, 28577428, 29541892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30692637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14639607, 17683807, 17942192, 22763881, 23365656, 24671823, 30583864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10769164, 24671823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	38095636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20974589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39201536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10188714, 12409228, 14706566, 15277233, 20008985, 20014941, 21769421, 24671823, 31560089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12409228, 1357630, 30810849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25390694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18383383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10816627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27891695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27891695	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12573802, 20483910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	BEFREE	12573802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22763881, 28577428, 29541892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16888207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	12601755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18383379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18383379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	1357630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23707988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30692637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17611633		★★★★★ ★☆☆☆☆ Found in Text Mining only

VIPR1 (vasoactive intestinal peptide receptor 1)