Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7432
Gene name	Vasoactive intestinal peptide
Gene symbol	VIP
Synonyms (NCBI Gene)	PHM27
Chromosome	6
Chromosome location	6q25.2
Summary	The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The

Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016951	hsa-miR-335-5p	Microarray	18185580
MIRT1484931	hsa-miR-181a	CLIP-seq
MIRT1484932	hsa-miR-181b	CLIP-seq
MIRT1484933	hsa-miR-181c	CLIP-seq
MIRT1484934	hsa-miR-181d	CLIP-seq
MIRT1484935	hsa-miR-2276	CLIP-seq
MIRT1484936	hsa-miR-338-5p	CLIP-seq
MIRT1484937	hsa-miR-3591-3p	CLIP-seq
MIRT1484938	hsa-miR-4262	CLIP-seq
MIRT1484939	hsa-miR-4686	CLIP-seq
MIRT1484940	hsa-miR-4772-3p	CLIP-seq
MIRT1484941	hsa-miR-513b	CLIP-seq
MIRT1484942	hsa-miR-548c-3p	CLIP-seq
MIRT1484943	hsa-miR-185	CLIP-seq
MIRT1484944	hsa-miR-3671	CLIP-seq
MIRT1484945	hsa-miR-371-5p	CLIP-seq
MIRT1484946	hsa-miR-371b-5p	CLIP-seq
MIRT1484947	hsa-miR-4306	CLIP-seq
MIRT1484948	hsa-miR-4433	CLIP-seq
MIRT1484949	hsa-miR-4459	CLIP-seq
MIRT1484950	hsa-miR-4644	CLIP-seq
MIRT1484951	hsa-miR-4680-5p	CLIP-seq
MIRT1484952	hsa-miR-4699-3p	CLIP-seq
MIRT1484953	hsa-miR-4768-3p	CLIP-seq
MIRT1484954	hsa-miR-9	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CREB1	Unknown	1847391
REST	Unknown	15009665
STAT1	Unknown	12425940

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001878	Process	Response to yeast	IDA	18603306
GO:0005179	Function	Hormone activity	IDA	9603988
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	3456568, 36385145
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	10096039
GO:0005515	Function	Protein binding	IPI	21314817, 23597562, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8933357, 36385145
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10096039
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8933357, 17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8933357, 9603988, 36385145
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007589	Process	Body fluid secretion	TAS	4035357
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8389448
GO:0019731	Process	Antibacterial humoral response	IDA	18603306
GO:0019732	Process	Antifungal humoral response	IDA	18603306
GO:0031891	Function	Type 1 vasoactive intestinal polypeptide receptor binding	IDA	36385145
GO:0031892	Function	Type 2 vasoactive intestinal polypeptide receptor binding	IDA	8933357
GO:0032880	Process	Regulation of protein localization	IBA
GO:0032880	Process	Regulation of protein localization	IDA	9603988
GO:0032880	Process	Regulation of protein localization	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0045087	Process	Innate immune response	IDA	18603306
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	9603988
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0048242	Process	Epinephrine secretion	IBA
GO:0048255	Process	MRNA stabilization	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	18603306
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	18603306
GO:0051428	Function	Peptide hormone receptor binding	IBA
GO:0051428	Function	Peptide hormone receptor binding	IPI	8390245
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	18603306
GO:0070459	Process	Prolactin secretion	ISS
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IBA

MIM	HGNC	e!Ensembl
192320	12693	ENSG00000146469

P01282

Protein name

VIP peptides [Cleaved into: Intestinal peptide PHV-42 (Peptide histidine valine 42) (PHV-42); Intestinal peptide PHM-27 (Peptide histidine methioninamide 27) (PHM-27); Vasoactive intestinal peptide (VIP) (Vasoactive intestinal polypeptide)]

Protein function

[Vasoactive intestinal peptide]: VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed

PDB

2RRH , 2RRI , 8E3Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00123	Hormone_2	81 → 108	Peptide hormone	Family
PF00123	Hormone_2	125 → 152	Peptide hormone	Family

Sequence

MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Sequence length

170

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASPERGER SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS, PULMONARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

VIP (vasoactive intestinal peptide)