EZR (ezrin)

Gene

• Entrez ID: 7430
• Gene name: Ezrin
• Gene symbol: EZR
• Synonyms (NCBI Gene): CVIL, CVL, HEL-S-105, VIL2
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytosk

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004349	hsa-miR-183-5p	Luciferase reporter assay	18840437
MIRT004349	hsa-miR-183-5p	Review	19935707
MIRT004349	hsa-miR-183-5p	Luciferase reporter assay	18840437
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21282569
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay	21416062
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay	21416062
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay	21416062
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay	21416062
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay	21416062
MIRT005825	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay	21416062
MIRT031338	hsa-miR-18a-5p	Sequencing	20371350
MIRT050361	hsa-miR-25-3p	CLASH	23622248
MIRT049846	hsa-miR-92a-3p	CLASH	23622248
MIRT046802	hsa-miR-222-3p	CLASH	23622248
MIRT045629	hsa-miR-149-5p	CLASH	23622248
MIRT045001	hsa-miR-186-5p	CLASH	23622248
MIRT045001	hsa-miR-186-5p	CLASH	23622248
MIRT043797	hsa-miR-328-3p	CLASH	23622248
MIRT040344	hsa-miR-615-3p	CLASH	23622248
MIRT035925	hsa-miR-1180-3p	CLASH	23622248
MIRT004349	hsa-miR-183-5p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25337200
MIRT004349	hsa-miR-183-5p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25337200
MIRT438290	hsa-miR-184	Luciferase reporter assay, qRT-PCR, Western blot	25251993
MIRT004349	hsa-miR-183-5p	qRT-PCR	24352761
MIRT438290	hsa-miR-184	Luciferase reporter assay, qRT-PCR, Western blot	25251993
MIRT004349	hsa-miR-183-5p	qRT-PCR	24352761
MIRT537541	hsa-miR-3677-5p	PAR-CLIP	22012620
MIRT537540	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT537539	hsa-miR-6730-3p	PAR-CLIP	22012620
MIRT537538	hsa-miR-3660	PAR-CLIP	22012620
MIRT537537	hsa-miR-4526	PAR-CLIP	22012620
MIRT537536	hsa-miR-6719-3p	PAR-CLIP	22012620
MIRT537535	hsa-miR-4294	PAR-CLIP	22012620
MIRT537534	hsa-miR-3622b-5p	PAR-CLIP	22012620
MIRT537533	hsa-miR-1257	PAR-CLIP	22012620
MIRT537532	hsa-miR-6818-5p	PAR-CLIP	22012620
MIRT440697	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT440697	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT440697	hsa-miR-205-5p	Luciferase reporter assay, Microarray	25597268
MIRT440697	hsa-miR-205-5p	Luciferase reporter assay, Microarray	25597268
MIRT734711	hsa-miR-28-3p	Western blotting, Microarray, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry	32664538
MIRT734712	hsa-miR-193a-5p	Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry	32664538
MIRT734713	hsa-miR-218-5p	Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry	32664538
MIRT734714	hsa-miR-452-5p	Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR, Flow cytometry	32664538
MIRT537541	hsa-miR-3677-5p	PAR-CLIP	22012620
MIRT537540	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT537539	hsa-miR-6730-3p	PAR-CLIP	22012620
MIRT537538	hsa-miR-3660	PAR-CLIP	22012620
MIRT537537	hsa-miR-4526	PAR-CLIP	22012620
MIRT537536	hsa-miR-6719-3p	PAR-CLIP	22012620
MIRT537535	hsa-miR-4294	PAR-CLIP	22012620
MIRT537534	hsa-miR-3622b-5p	PAR-CLIP	22012620
MIRT537533	hsa-miR-1257	PAR-CLIP	22012620
MIRT537532	hsa-miR-6818-5p	PAR-CLIP	22012620
MIRT973978	hsa-miR-1303	CLIP-seq
MIRT973979	hsa-miR-18a	CLIP-seq
MIRT973980	hsa-miR-18b	CLIP-seq
MIRT973981	hsa-miR-1908	CLIP-seq
MIRT973982	hsa-miR-1972	CLIP-seq
MIRT973983	hsa-miR-299-5p	CLIP-seq
MIRT973984	hsa-miR-3121-3p	CLIP-seq
MIRT973985	hsa-miR-3129-3p	CLIP-seq
MIRT973986	hsa-miR-338-3p	CLIP-seq
MIRT973987	hsa-miR-34c-3p	CLIP-seq
MIRT973988	hsa-miR-3614-5p	CLIP-seq
MIRT973989	hsa-miR-377	CLIP-seq
MIRT973990	hsa-miR-409-3p	CLIP-seq
MIRT973991	hsa-miR-410	CLIP-seq
MIRT973992	hsa-miR-4481	CLIP-seq
MIRT973993	hsa-miR-4485	CLIP-seq
MIRT973994	hsa-miR-4492	CLIP-seq
MIRT973995	hsa-miR-4498	CLIP-seq
MIRT973996	hsa-miR-4508	CLIP-seq
MIRT973997	hsa-miR-4522	CLIP-seq
MIRT973998	hsa-miR-4670-3p	CLIP-seq
MIRT973999	hsa-miR-4731-3p	CLIP-seq
MIRT974000	hsa-miR-4735-3p	CLIP-seq
MIRT974001	hsa-miR-4742-3p	CLIP-seq
MIRT974002	hsa-miR-4745-5p	CLIP-seq
MIRT974003	hsa-miR-4758-5p	CLIP-seq
MIRT974004	hsa-miR-4762-5p	CLIP-seq
MIRT974005	hsa-miR-4799-5p	CLIP-seq
MIRT974006	hsa-miR-4801	CLIP-seq
MIRT974007	hsa-miR-520d-5p	CLIP-seq
MIRT974008	hsa-miR-524-5p	CLIP-seq
MIRT974009	hsa-miR-568	CLIP-seq
MIRT974010	hsa-miR-630	CLIP-seq
MIRT974011	hsa-miR-643	CLIP-seq
MIRT974012	hsa-miR-663	CLIP-seq
MIRT974013	hsa-miR-744	CLIP-seq
MIRT974014	hsa-miR-762	CLIP-seq
MIRT974015	hsa-miR-877	CLIP-seq
MIRT974016	hsa-miR-885-3p	CLIP-seq
MIRT974017	hsa-miR-3126-5p	CLIP-seq
MIRT974018	hsa-miR-3200-5p	CLIP-seq
MIRT974019	hsa-miR-384	CLIP-seq
MIRT974020	hsa-miR-432	CLIP-seq
MIRT974021	hsa-miR-4419a	CLIP-seq
MIRT973993	hsa-miR-4485	CLIP-seq
MIRT974022	hsa-miR-4510	CLIP-seq
MIRT974023	hsa-miR-4649-3p	CLIP-seq
MIRT974024	hsa-miR-4722-3p	CLIP-seq
MIRT973999	hsa-miR-4731-3p	CLIP-seq
MIRT974025	hsa-miR-4744	CLIP-seq
MIRT974006	hsa-miR-4801	CLIP-seq
MIRT974026	hsa-miR-548u	CLIP-seq
MIRT974027	hsa-miR-890	CLIP-seq
MIRT1988551	hsa-miR-1252	CLIP-seq
MIRT1988552	hsa-miR-1281	CLIP-seq
MIRT1988553	hsa-miR-1322	CLIP-seq
MIRT1988554	hsa-miR-148a	CLIP-seq
MIRT1988555	hsa-miR-148b	CLIP-seq
MIRT1988556	hsa-miR-152	CLIP-seq
MIRT973982	hsa-miR-1972	CLIP-seq
MIRT973984	hsa-miR-3121-3p	CLIP-seq
MIRT973986	hsa-miR-338-3p	CLIP-seq
MIRT1988557	hsa-miR-345	CLIP-seq
MIRT973987	hsa-miR-34c-3p	CLIP-seq
MIRT1988558	hsa-miR-3611	CLIP-seq
MIRT973988	hsa-miR-3614-5p	CLIP-seq
MIRT973989	hsa-miR-377	CLIP-seq
MIRT973991	hsa-miR-410	CLIP-seq
MIRT1988559	hsa-miR-4292	CLIP-seq
MIRT1988560	hsa-miR-4304	CLIP-seq
MIRT1988561	hsa-miR-4308	CLIP-seq
MIRT1988562	hsa-miR-4428	CLIP-seq
MIRT1988563	hsa-miR-4438	CLIP-seq
MIRT973992	hsa-miR-4481	CLIP-seq
MIRT1988564	hsa-miR-4494	CLIP-seq
MIRT1988565	hsa-miR-4519	CLIP-seq
MIRT973997	hsa-miR-4522	CLIP-seq
MIRT1988566	hsa-miR-4642	CLIP-seq
MIRT973998	hsa-miR-4670-3p	CLIP-seq
MIRT1988567	hsa-miR-4690-3p	CLIP-seq
MIRT1988568	hsa-miR-4705	CLIP-seq
MIRT1988569	hsa-miR-4717-3p	CLIP-seq
MIRT974024	hsa-miR-4722-3p	CLIP-seq
MIRT1988570	hsa-miR-4728-3p	CLIP-seq
MIRT974025	hsa-miR-4744	CLIP-seq
MIRT974002	hsa-miR-4745-5p	CLIP-seq
MIRT974003	hsa-miR-4758-5p	CLIP-seq
MIRT1988571	hsa-miR-4760-3p	CLIP-seq
MIRT974004	hsa-miR-4762-5p	CLIP-seq
MIRT974005	hsa-miR-4799-5p	CLIP-seq
MIRT1988572	hsa-miR-495	CLIP-seq
MIRT1988573	hsa-miR-499a-5p	CLIP-seq
MIRT1988574	hsa-miR-5095	CLIP-seq
MIRT1988575	hsa-miR-510	CLIP-seq
MIRT1988576	hsa-miR-512-5p	CLIP-seq
MIRT1988577	hsa-miR-518a-5p	CLIP-seq
MIRT1988578	hsa-miR-527	CLIP-seq
MIRT1988579	hsa-miR-550b	CLIP-seq
MIRT1988580	hsa-miR-566	CLIP-seq
MIRT974009	hsa-miR-568	CLIP-seq
MIRT1988581	hsa-miR-628-5p	CLIP-seq
MIRT974011	hsa-miR-643	CLIP-seq
MIRT2222991	hsa-miR-1202	CLIP-seq
MIRT2222992	hsa-miR-1207-3p	CLIP-seq
MIRT2222993	hsa-miR-1208	CLIP-seq
MIRT2222994	hsa-miR-122	CLIP-seq
MIRT2222995	hsa-miR-1225-5p	CLIP-seq
MIRT2222996	hsa-miR-1236	CLIP-seq
MIRT1988551	hsa-miR-1252	CLIP-seq
MIRT2222997	hsa-miR-1271	CLIP-seq
MIRT2222998	hsa-miR-1289	CLIP-seq
MIRT1988553	hsa-miR-1322	CLIP-seq
MIRT1988554	hsa-miR-148a	CLIP-seq
MIRT1988555	hsa-miR-148b	CLIP-seq
MIRT1988556	hsa-miR-152	CLIP-seq
MIRT2222999	hsa-miR-1910	CLIP-seq
MIRT973982	hsa-miR-1972	CLIP-seq
MIRT2223000	hsa-miR-27a	CLIP-seq
MIRT2223001	hsa-miR-27b	CLIP-seq
MIRT973984	hsa-miR-3121-3p	CLIP-seq
MIRT2223002	hsa-miR-3135b	CLIP-seq
MIRT2223003	hsa-miR-3194-5p	CLIP-seq
MIRT2223004	hsa-miR-3198	CLIP-seq
MIRT973986	hsa-miR-338-3p	CLIP-seq
MIRT1988557	hsa-miR-345	CLIP-seq
MIRT2223005	hsa-miR-346	CLIP-seq
MIRT973987	hsa-miR-34c-3p	CLIP-seq
MIRT1988558	hsa-miR-3611	CLIP-seq
MIRT973988	hsa-miR-3614-5p	CLIP-seq
MIRT2223006	hsa-miR-3689d	CLIP-seq
MIRT2223007	hsa-miR-370	CLIP-seq
MIRT973989	hsa-miR-377	CLIP-seq
MIRT2223008	hsa-miR-3972	CLIP-seq
MIRT973991	hsa-miR-410	CLIP-seq
MIRT2223009	hsa-miR-412	CLIP-seq
MIRT2223010	hsa-miR-4288	CLIP-seq
MIRT1988560	hsa-miR-4304	CLIP-seq
MIRT2223011	hsa-miR-4309	CLIP-seq
MIRT1988562	hsa-miR-4428	CLIP-seq
MIRT2223012	hsa-miR-4459	CLIP-seq
MIRT1988565	hsa-miR-4519	CLIP-seq
MIRT2223013	hsa-miR-4520a-5p	CLIP-seq
MIRT2223014	hsa-miR-4520b-5p	CLIP-seq
MIRT973997	hsa-miR-4522	CLIP-seq
MIRT2223015	hsa-miR-455-3p	CLIP-seq
MIRT1988566	hsa-miR-4642	CLIP-seq
MIRT2223016	hsa-miR-4650-5p	CLIP-seq
MIRT973998	hsa-miR-4670-3p	CLIP-seq
MIRT1988568	hsa-miR-4705	CLIP-seq
MIRT1988569	hsa-miR-4717-3p	CLIP-seq
MIRT974024	hsa-miR-4722-3p	CLIP-seq
MIRT2223017	hsa-miR-4727-5p	CLIP-seq
MIRT1988570	hsa-miR-4728-3p	CLIP-seq
MIRT2223018	hsa-miR-4734	CLIP-seq
MIRT974001	hsa-miR-4742-3p	CLIP-seq
MIRT2223019	hsa-miR-4769-3p	CLIP-seq
MIRT2223020	hsa-miR-4797-5p	CLIP-seq
MIRT1988575	hsa-miR-510	CLIP-seq
MIRT1988576	hsa-miR-512-5p	CLIP-seq
MIRT2223021	hsa-miR-513a-5p	CLIP-seq
MIRT1988579	hsa-miR-550b	CLIP-seq
MIRT2223022	hsa-miR-555	CLIP-seq
MIRT974009	hsa-miR-568	CLIP-seq
MIRT1988581	hsa-miR-628-5p	CLIP-seq
MIRT2223023	hsa-miR-632	CLIP-seq
MIRT974011	hsa-miR-643	CLIP-seq
MIRT2223024	hsa-miR-654-3p	CLIP-seq
MIRT2223025	hsa-miR-765	CLIP-seq
MIRT2223026	hsa-miR-96	CLIP-seq
MIRT973982	hsa-miR-1972	CLIP-seq
MIRT1988564	hsa-miR-4494	CLIP-seq
MIRT973997	hsa-miR-4522	CLIP-seq
MIRT1988573	hsa-miR-499a-5p	CLIP-seq
MIRT974011	hsa-miR-643	CLIP-seq
MIRT2222991	hsa-miR-1202	CLIP-seq
MIRT2222993	hsa-miR-1208	CLIP-seq
MIRT973978	hsa-miR-1303	CLIP-seq
MIRT2526946	hsa-miR-134	CLIP-seq
MIRT2526947	hsa-miR-153	CLIP-seq
MIRT2526948	hsa-miR-2110	CLIP-seq
MIRT973983	hsa-miR-299-5p	CLIP-seq
MIRT2526949	hsa-miR-3064-3p	CLIP-seq
MIRT2526950	hsa-miR-3118	CLIP-seq
MIRT2223003	hsa-miR-3194-5p	CLIP-seq
MIRT2526951	hsa-miR-3607-3p	CLIP-seq
MIRT2526952	hsa-miR-3686	CLIP-seq
MIRT2526953	hsa-miR-380	CLIP-seq
MIRT2223008	hsa-miR-3972	CLIP-seq
MIRT2526954	hsa-miR-4271	CLIP-seq
MIRT2526955	hsa-miR-4418	CLIP-seq
MIRT2526956	hsa-miR-4495	CLIP-seq
MIRT2223013	hsa-miR-4520a-5p	CLIP-seq
MIRT2223014	hsa-miR-4520b-5p	CLIP-seq
MIRT2526957	hsa-miR-4659a-5p	CLIP-seq
MIRT2526958	hsa-miR-4659b-5p	CLIP-seq
MIRT2526959	hsa-miR-4666-5p	CLIP-seq
MIRT2526960	hsa-miR-4667-5p	CLIP-seq
MIRT2526961	hsa-miR-4668-5p	CLIP-seq
MIRT2526962	hsa-miR-4685-5p	CLIP-seq
MIRT2526963	hsa-miR-4700-5p	CLIP-seq
MIRT2526964	hsa-miR-4725-3p	CLIP-seq
MIRT2223017	hsa-miR-4727-5p	CLIP-seq
MIRT2223019	hsa-miR-4769-3p	CLIP-seq
MIRT2526965	hsa-miR-4778-5p	CLIP-seq
MIRT1988572	hsa-miR-495	CLIP-seq
MIRT2526966	hsa-miR-499-3p	CLIP-seq
MIRT2526967	hsa-miR-499a-3p	CLIP-seq
MIRT2526968	hsa-miR-500a	CLIP-seq
MIRT2526969	hsa-miR-509-3-5p	CLIP-seq
MIRT2526970	hsa-miR-509-5p	CLIP-seq
MIRT2526971	hsa-miR-548ag	CLIP-seq
MIRT2526972	hsa-miR-548ai	CLIP-seq
MIRT2526973	hsa-miR-548m	CLIP-seq
MIRT2526974	hsa-miR-548n	CLIP-seq
MIRT2526975	hsa-miR-548t	CLIP-seq
MIRT1988580	hsa-miR-566	CLIP-seq
MIRT2526976	hsa-miR-570	CLIP-seq
MIRT2526977	hsa-miR-595	CLIP-seq
MIRT2526978	hsa-miR-648	CLIP-seq
MIRT974015	hsa-miR-877	CLIP-seq
MIRT2526979	hsa-miR-885-5p	CLIP-seq
MIRT1988572	hsa-miR-495	CLIP-seq
MIRT2680427	hsa-miR-103a	CLIP-seq
MIRT2680428	hsa-miR-107	CLIP-seq
MIRT2680429	hsa-miR-1184	CLIP-seq
MIRT973978	hsa-miR-1303	CLIP-seq
MIRT2526946	hsa-miR-134	CLIP-seq
MIRT2526947	hsa-miR-153	CLIP-seq
MIRT2680430	hsa-miR-214	CLIP-seq
MIRT973983	hsa-miR-299-5p	CLIP-seq
MIRT2526949	hsa-miR-3064-3p	CLIP-seq
MIRT2526950	hsa-miR-3118	CLIP-seq
MIRT2526951	hsa-miR-3607-3p	CLIP-seq
MIRT2680431	hsa-miR-3619-5p	CLIP-seq
MIRT2526952	hsa-miR-3686	CLIP-seq
MIRT2526953	hsa-miR-380	CLIP-seq
MIRT2680432	hsa-miR-4267	CLIP-seq
MIRT2526955	hsa-miR-4418	CLIP-seq
MIRT2526956	hsa-miR-4495	CLIP-seq
MIRT2680433	hsa-miR-4514	CLIP-seq
MIRT2526957	hsa-miR-4659a-5p	CLIP-seq
MIRT2526958	hsa-miR-4659b-5p	CLIP-seq
MIRT2526959	hsa-miR-4666-5p	CLIP-seq
MIRT2680434	hsa-miR-4690-5p	CLIP-seq
MIRT2680435	hsa-miR-4692	CLIP-seq
MIRT2680436	hsa-miR-4736	CLIP-seq
MIRT2526965	hsa-miR-4778-5p	CLIP-seq
MIRT2526966	hsa-miR-499-3p	CLIP-seq
MIRT2526967	hsa-miR-499a-3p	CLIP-seq
MIRT2526968	hsa-miR-500a	CLIP-seq
MIRT2526969	hsa-miR-509-3-5p	CLIP-seq
MIRT2526970	hsa-miR-509-5p	CLIP-seq
MIRT2526974	hsa-miR-548n	CLIP-seq
MIRT2526975	hsa-miR-548t	CLIP-seq
MIRT2526977	hsa-miR-595	CLIP-seq
MIRT2526978	hsa-miR-648	CLIP-seq
MIRT2680437	hsa-miR-761	CLIP-seq
MIRT974015	hsa-miR-877	CLIP-seq
MIRT2526979	hsa-miR-885-5p	CLIP-seq
MIRT2680438	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Activation	19164283
JUN	Activation	19164283
SP1	Activation	19164283

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20551903
GO:0001650	Component	Fibrillar center	IDA
GO:0001726	Component	Ruffle	IDA	9852149, 25554515
GO:0001772	Component	Immunological synapse	IDA	17911601
GO:0001772	Component	Immunological synapse	IDA	20551903
GO:0001931	Component	Uropod	IEA
GO:0001951	Process	Intestinal D-glucose absorption	IEA
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IMP	23106337
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IDA	17825285
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	7844168, 10793131, 10806479, 11598191, 12651155, 15020681, 15498789, 17046996, 17242191, 17500595, 17911601, 18046454, 19555689, 20195357, 20442317, 20551903, 20937695, 21148287, 21849478, 22570591, 22805611, 23414517, 24555568, 24658140, 25554515, 26496610, 28514442, 29568061, 3183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005737	Component	Cytoplasm	IDA	23106337, 25554515
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	21148287
GO:0005829	Component	Cytosol	IDA	9852149
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	11598191
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	7844168, 23106337
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IBA
GO:0005902	Component	Microvillus	IDA	12082081
GO:0005902	Component	Microvillus	IEA
GO:0005903	Component	Brush border	IEA
GO:0005903	Component	Brush border	ISS
GO:0005912	Component	Adherens junction	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA	21282464
GO:0005938	Component	Cell cortex	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IEP	12082081
GO:0008017	Function	Microtubule binding	IMP	23857773
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	20551903
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	23264465
GO:0010737	Process	Protein kinase A signaling	IMP	17911601
GO:0015629	Component	Actin cytoskeleton	IDA	10793131
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IDA	17825285, 22797597, 24862762
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019904	Function	Protein domain specific binding	IPI	25554515
GO:0022612	Process	Gland morphogenesis	IMP	24862762
GO:0022614	Process	Membrane to membrane docking	IEP	12082081
GO:0030033	Process	Microvillus assembly	IMP	22797597
GO:0030036	Process	Actin cytoskeleton organization	IMP	23106337
GO:0030175	Component	Filopodium	IBA
GO:0030175	Component	Filopodium	IDA	12082081, 23106337
GO:0030863	Component	Cortical cytoskeleton	TAS	11598191
GO:0030953	Process	Astral microtubule organization	IMP	20551903
GO:0031503	Process	Protein-containing complex localization	IMP	20551903
GO:0031528	Component	Microvillus membrane	IEA
GO:0031623	Process	Receptor internalization	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032532	Process	Regulation of microvillus length	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	17911601
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	20551903
GO:0032991	Component	Protein-containing complex	IDA	25097019
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	17911601
GO:0034237	Function	Protein kinase A regulatory subunit binding	IPI	17911601
GO:0035088	Process	Establishment or maintenance of apical/basal cell polarity	IEA
GO:0036064	Component	Ciliary basal body	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 29568061, 31837246
GO:0042995	Component	Cell projection	IDA	25889165
GO:0042995	Component	Cell projection	IEA
GO:0043622	Process	Cortical microtubule organization	IMP	20551903
GO:0044548	Function	S100 protein binding	IPI	25554515
GO:0044853	Component	Plasma membrane raft	IDA	17911601
GO:0045177	Component	Apical part of cell	IBA
GO:0045177	Component	Apical part of cell	IDA	12082081
GO:0045177	Component	Apical part of cell	IEA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IMP	24862762
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IGI	21148287
GO:0046847	Process	Filopodium assembly	IMP	23106337
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	24862762
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0050839	Function	Cell adhesion molecule binding	IPI	12082081, 15498789
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IMP	20551903
GO:0051015	Function	Actin filament binding	IDA	10793131
GO:0051017	Process	Actin filament bundle assembly	IDA	10793131
GO:0051018	Function	Protein kinase A binding	IPI	25097019
GO:0051117	Function	ATPase binding	IPI	17825285
GO:0051660	Process	Establishment of centrosome localization	IMP	20551903
GO:0061028	Process	Establishment of endothelial barrier	IEA
GO:0061028	Process	Establishment of endothelial barrier	IGI	23264465
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	20551903
GO:0071320	Process	Cellular response to cAMP	IMP	17911601
GO:0071944	Component	Cell periphery	IDA	22291017
GO:0072659	Process	Protein localization to plasma membrane	IMP	17825285, 17911601
GO:0072697	Process	Protein localization to cell cortex	IMP	25554515
GO:0097718	Function	Disordered domain specific binding	IEA
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IEA
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IMP	20551903
GO:1902115	Process	Regulation of organelle assembly	IBA
GO:1902115	Process	Regulation of organelle assembly	IEA
GO:1902115	Process	Regulation of organelle assembly	IGI	21148287
GO:1902115	Process	Regulation of organelle assembly	IMP	21148287
GO:1902896	Process	Terminal web assembly	IEA
GO:1902966	Process	Positive regulation of protein localization to early endosome	IBA
GO:1902966	Process	Positive regulation of protein localization to early endosome	IEA
GO:1902966	Process	Positive regulation of protein localization to early endosome	IGI	21148287
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903753	Process	Negative regulation of p38MAPK cascade	IMP	20551903
GO:2000643	Process	Positive regulation of early endosome to late endosome transport	IBA
GO:2000643	Process	Positive regulation of early endosome to late endosome transport	IEA
GO:2000643	Process	Positive regulation of early endosome to late endosome transport	IGI	21148287
GO:2000643	Process	Positive regulation of early endosome to late endosome transport	IMP	21148287

Other IDs

• MIM: 123900
• HGNC: 12691
• e!Ensembl: ENSG00000092820

Protein

• UniProt ID: P15311
• Protein name: Ezrin (Cytovillin) (Villin-2) (p81)
• Protein function: Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocyt
• PDB: 1NI2, 4RM8, 4RM9, 4RMA, 7T1K, 7T1L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09379	FERM_N	9 → 71	FERM N-terminal domain	Domain
  PF00373	FERM_M	88 → 206	FERM central domain	Domain
  PF09380	FERM_C	210 → 299	FERM C-terminal PH-like domain	Domain
  PF00769	ERM	338 → 586	Ezrin/radixin/moesin family	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. Weakly expressed in brain stem and diencephalon. Stronger expression was detected in gray matter of frontal lobe compared to white matter (at protei
• Sequence:

  MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
  LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
  TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
  GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
  PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
  EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
  AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
  LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
  VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
  ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL

• Sequence length: 586

Pathways

KEGG:

Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Gastric acid secretion
Pathogenic Escherichia coli infection
Proteoglycans in cancer
MicroRNAs in cancer

Reactome:

Netrin-1 signaling
Recycling pathway of L1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOSOMAL RECESSIVE NON-SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENCEPHALITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EZR-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Absence of septum pellucidum	Absence Of Septum Pellucidum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	27499265		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	21465252		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11092524, 16142420, 28423676, 29361925		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10329398		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25801911		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19088174		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25251993		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	25820557		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	25820557	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29660901, 30655325		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	23174138	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28702704, 30290132		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11106550, 34723710	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23712870, 31382374		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	24413175	Associate	★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autosomal recessive non-syndromic intellectual disability	Non-Syndromic Intellectual Disability	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31819366		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	34392560	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20811677, 20858276, 23900701, 25955302, 26246600, 26469327, 28364518, 29132012, 30678714, 30804430, 31452341, 31638145		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19550117, 21818323, 23420497, 26938523, 27622508, 31578772, 32028690, 36923551, 36938826, 37304008	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24086451, 31452341	Stimulate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	16795069	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15882268, 19164283, 21412073, 26936397, 30282070	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10329398, 21751142, 27628318, 28300573, 30996241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	26429873	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24518705	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	16554733	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18425081, 19604375, 23766411, 28230040, 28858082, 32639665, 32647287	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	32281236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17370040, 18840437, 22528947, 29886078		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24885195, 26026587, 26419932, 34121685, 8579099	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25400809, 30344309, 32281236, 40049807	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	16554733		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	16554733, 17525629		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11753986, 16633060, 16824698, 22477337, 27622508		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	28450710	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	8579099	Associate	★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21874375, 24182314, 26933912, 28355349, 29587669, 30282070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21874375, 24182314, 28355349		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21874375, 26933912, 28355349, 29587669, 30282070		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19088174		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21412073	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	26212029		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	26212029	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15596224		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27499265		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	27401686		★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24385580		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16762451, 22869145, 23755307, 27499265		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20558337, 21465252	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24462708		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19399936, 20501702, 21465252, 22869145, 24462708, 24581231, 28261953, 28535417, 29190988, 29291001, 29599290, 30244250, 31175699, 31693738		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18701134		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20872967, 21465252, 26010871, 27499265, 27512995, 28953975, 29599290, 31175699, 32293320, 32334457, 33974673, 34938284, 37629086	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28261953	Stimulate	★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	35793608	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20395446, 26026587, 26419932, 31648868		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30655286	Associate	★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	8579099	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	26140448	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26140448, 26823603, 28883468		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35954202	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26258413		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26258413		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37576973	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26032400		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25801911, 29966970		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	20128822	Stimulate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	26469327		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10660086, 11753986, 29206870, 30226564		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	37774078	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10660086, 28421904, 30226564, 37774078	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17525629, 18552365		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22544491		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22477337		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19164283, 21628504, 22196440		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19164283, 20128822, 21628504	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22196440		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19164283, 20128822, 20193117, 25126570, 25915860, 31886273, 37328063	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17028919, 31811703		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	33978304	Stimulate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	20585869		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	14724156, 15929122, 19648886	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	15326474, 15929122, 19648886, 21971708		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	25929323	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11106550	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11146166, 20156804		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11146166, 20156804		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20167812, 25055875, 28232157		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20167812	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	16522749	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19604375	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26045796	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	16554733	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	16144921		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18685143		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24385580, 29324356		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29324356		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome 1	Kallmann Syndrome	BEFREE	25892360		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	16522749	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25920588		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23209815, 23394223, 25299115		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23422152		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18425081		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20969862, 22045674, 23766411, 25892360, 28230040, 28608644, 28858082		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	19604375	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26212029	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26140448		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	18676875	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	18676875		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17370040		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18840437, 22528947	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30021765		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17237445	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30021765		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30021765		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17237445	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30021765		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20193117, 25299115, 28355349, 30282070, 31175699	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21717114, 21874375, 23039327, 23209815, 24182314	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	22528947, 27914826, 28608644		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26010871	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25251993, 30946360	Associate	★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	24413175		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndromes	Malabsorption syndrome	Pubtator	24413175	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	14704789		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	18545143, 28079637		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	LHGDN	18545143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20811677, 20858276, 23900701, 25955302, 26246600, 26469327, 28364518, 29132012, 30463939, 30678714, 30804430, 31452341, 31638145		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10660086, 30226564		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22196440, 29190988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29190988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17370040, 18840437, 22528947, 29886078		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23422152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16633060, 16824698, 27622508		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18852256, 28298808, 31372056		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15028477, 16873375, 20010876, 22629406		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881, 17566973, 24763052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21717114, 25096402, 31807065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	24346284		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10462524, 11753986, 12711360, 15121044, 16488997, 19399936, 20128822, 20585869, 20930524, 21465252, 22286748, 22922800, 23067217, 23098471, 23507543, 23712870, 23752190, 24824262, 25126570, 25915860, 26149384, 26209696, 27622508, 28230040, 28300573, 29253179, 30083837, 30244410, 30344309, 30678714, 30804430, 31289527, 31638145		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21874375, 26933912, 28355349, 29587669, 30282070		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16762451, 22869145, 27499265		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16538541, 17370041, 18155831		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24086451		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19088174		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14615410, 36142656, 37629086	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27793041, 29210059		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	15475929	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	8586465		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	16522749	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Microvillus Inclusion Disease	BEFREE	24413175		★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Microvillus inclusion disease	Pubtator	24413175, 26526116	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30101710		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	35793608	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17270023, 29886078, 31289527		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17270023, 19234486, 21625943, 25375189, 25378401	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11070492, 16144921, 16324214, 16677779, 16795069, 18545143, 19165868, 19399936, 20167812, 20856924, 21465252, 21717114, 21874375, 21971708, 22147261, 22922800, 23067217, 23209815, 23357878, 23712870, 23766411, 24352761, 24462708, 25613038, 25801911, 25854173, 26820701, 26933912, 27276064, 28230040, 28423676, 28535417, 28953975, 29190988, 29210059, 29391894, 30143526, 30282070, 30344309, 30655800, 30678714, 31039200, 31376222, 31452341, 31648868, 31807237, 8479753, 9553042, 9748471		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	16522749	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16522749	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	25920588		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	9403715		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33326488	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	11070492, 14724586, 16324214, 18332868, 20156804, 24297905, 30143526, 9553042		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22137559, 24629131, 26936397, 31131053		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	25820557		★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14676807, 15121044, 16677779, 17609619, 17786474, 18245461, 19366061, 21360024, 21780101, 22147261, 22286748, 22525461, 22922800, 23644663, 23803027, 23959472, 24014052, 24352761, 24614149, 24824262, 24924175, 25075031, 25848766, 25854173, 26149384, 26311104, 27900754, 29391894, 29628496, 29656060, 29899165, 30836200, 31333725		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	14676807, 18245461, 19597468, 20348881, 21559778, 22525461, 22577345, 25854173, 27207343, 29899165, 31333725, 35012433	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	14704791, 16677779, 17786474, 17886294		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	16633060, 27622508		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16824698		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27622508, 33685573	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18852256, 28298808, 31372056		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29660901, 30655325		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	19152423		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15908786, 19608876, 23098471, 31912905	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	8579099	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	25286001		★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	30654004		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	BEFREE	25504542		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15028477, 16873375, 20010876		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16873375	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15028477, 16873375		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16230228, 18459457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16873375, 26799186	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881, 17566973, 24763052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35156523	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25591774, 33978304	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	18676875, 33978304	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22199327		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20395446, 26026587, 26419932		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25406076		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	24462708, 29599290		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28702704		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	14704789, 15121044, 16488997, 20856924		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	14704789		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	22577345	Associate	★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	16144921, 17028919, 31376222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	16144921, 17028919, 17370041		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Synovial	Synovial sarcoma	Pubtator	25613038	Associate	★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34502121	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	22204275	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23422152, 27628318, 27688241, 30344309		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16585385, 19164283, 19165868, 20128822, 24569468, 25126570, 25915860, 26397940, 26980013, 28298808, 28504189, 28603065, 29253179, 31082616, 31409639		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16698950, 22228071, 23209815, 23357878, 25299115, 38011007	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25400809		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	23357878		★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	16144921		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21717114, 21751142, 25096402, 31807065		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17659733, 21282970, 21717114, 23039327, 25337200, 36522839	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	25613038		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26648031		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30101710		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30996241		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30654768, 30996241	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	32281236	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26469327, 30244410, 30999280		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36938826	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24885195, 25278252, 37061568	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21874375	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21874375, 24182314, 26933912, 28355349, 29587669, 30282070, 32674647, 34577118, 40049807	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Uterine Cervicitis	BEFREE	28355349		★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	28843271	Associate	★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Associate	★☆☆☆☆ Found in Text Mining only