VGF (VGF nerve growth factor inducible)

Gene

• Entrez ID: 7425
• Gene name: VGF nerve growth factor inducible
• Gene symbol: VGF
• Synonyms (NCBI Gene): SCG7, SgVII
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions sh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT491307	hsa-miR-3195	PAR-CLIP	20371350
MIRT491300	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT491299	hsa-miR-4488	PAR-CLIP	20371350
MIRT491298	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT491297	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT491296	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT491307	hsa-miR-3195	PAR-CLIP	23592263
MIRT491306	hsa-miR-4479	PAR-CLIP	23592263
MIRT491305	hsa-miR-3960	PAR-CLIP	23592263
MIRT491304	hsa-miR-8072	PAR-CLIP	23592263
MIRT491303	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491302	hsa-miR-663a	PAR-CLIP	23592263
MIRT491301	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491300	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT491299	hsa-miR-4488	PAR-CLIP	23592263
MIRT491298	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT491297	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT491296	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT491307	hsa-miR-3195	PAR-CLIP	20371350
MIRT491300	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT491299	hsa-miR-4488	PAR-CLIP	20371350
MIRT491298	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT491297	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT491296	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT491307	hsa-miR-3195	PAR-CLIP	23592263
MIRT491306	hsa-miR-4479	PAR-CLIP	23592263
MIRT491305	hsa-miR-3960	PAR-CLIP	23592263
MIRT491304	hsa-miR-8072	PAR-CLIP	23592263
MIRT491303	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491302	hsa-miR-663a	PAR-CLIP	23592263
MIRT491301	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491300	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT491299	hsa-miR-4488	PAR-CLIP	23592263
MIRT491298	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT491297	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT491296	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT1484239	hsa-miR-1207-5p	CLIP-seq
MIRT1484240	hsa-miR-1270	CLIP-seq
MIRT1484241	hsa-miR-185	CLIP-seq
MIRT1484242	hsa-miR-27a	CLIP-seq
MIRT1484243	hsa-miR-27b	CLIP-seq
MIRT1484244	hsa-miR-3135b	CLIP-seq
MIRT1484245	hsa-miR-3140-3p	CLIP-seq
MIRT1484246	hsa-miR-3154	CLIP-seq
MIRT1484247	hsa-miR-3179	CLIP-seq
MIRT1484248	hsa-miR-3184	CLIP-seq
MIRT1484249	hsa-miR-3652	CLIP-seq
MIRT1484250	hsa-miR-3677-3p	CLIP-seq
MIRT1484251	hsa-miR-3689a-3p	CLIP-seq
MIRT1484252	hsa-miR-3689c	CLIP-seq
MIRT1484253	hsa-miR-377	CLIP-seq
MIRT1484254	hsa-miR-3918	CLIP-seq
MIRT1484255	hsa-miR-3919	CLIP-seq
MIRT1484256	hsa-miR-3936	CLIP-seq
MIRT1484257	hsa-miR-423-5p	CLIP-seq
MIRT1484258	hsa-miR-4283	CLIP-seq
MIRT1484259	hsa-miR-4306	CLIP-seq
MIRT1484260	hsa-miR-432	CLIP-seq
MIRT1484261	hsa-miR-4430	CLIP-seq
MIRT1484262	hsa-miR-4446-3p	CLIP-seq
MIRT1484263	hsa-miR-4492	CLIP-seq
MIRT1484264	hsa-miR-4498	CLIP-seq
MIRT1484265	hsa-miR-4531	CLIP-seq
MIRT1484266	hsa-miR-4532	CLIP-seq
MIRT1484267	hsa-miR-4644	CLIP-seq
MIRT1484268	hsa-miR-4688	CLIP-seq
MIRT1484269	hsa-miR-4699-3p	CLIP-seq
MIRT1484270	hsa-miR-4716-3p	CLIP-seq
MIRT1484271	hsa-miR-4723-5p	CLIP-seq
MIRT1484272	hsa-miR-4728-5p	CLIP-seq
MIRT1484273	hsa-miR-4747-3p	CLIP-seq
MIRT1484274	hsa-miR-4763-3p	CLIP-seq
MIRT1484275	hsa-miR-485-5p	CLIP-seq
MIRT1484276	hsa-miR-486-3p	CLIP-seq
MIRT1484277	hsa-miR-513a-5p	CLIP-seq
MIRT1484278	hsa-miR-582-3p	CLIP-seq
MIRT1484279	hsa-miR-603	CLIP-seq
MIRT1484280	hsa-miR-620	CLIP-seq
MIRT1484281	hsa-miR-762	CLIP-seq
MIRT1484282	hsa-miR-890	CLIP-seq
MIRT1484283	hsa-miR-939	CLIP-seq
MIRT2145772	hsa-miR-1180	CLIP-seq
MIRT1484240	hsa-miR-1270	CLIP-seq
MIRT2145773	hsa-miR-1471	CLIP-seq
MIRT1484241	hsa-miR-185	CLIP-seq
MIRT2145774	hsa-miR-2355-5p	CLIP-seq
MIRT1484242	hsa-miR-27a	CLIP-seq
MIRT1484243	hsa-miR-27b	CLIP-seq
MIRT2145775	hsa-miR-296-5p	CLIP-seq
MIRT2145776	hsa-miR-31	CLIP-seq
MIRT2145777	hsa-miR-3126-5p	CLIP-seq
MIRT1484244	hsa-miR-3135b	CLIP-seq
MIRT1484245	hsa-miR-3140-3p	CLIP-seq
MIRT1484248	hsa-miR-3184	CLIP-seq
MIRT2145778	hsa-miR-3191	CLIP-seq
MIRT1484249	hsa-miR-3652	CLIP-seq
MIRT2145779	hsa-miR-3675-5p	CLIP-seq
MIRT2145780	hsa-miR-3688-5p	CLIP-seq
MIRT1484253	hsa-miR-377	CLIP-seq
MIRT1484257	hsa-miR-423-5p	CLIP-seq
MIRT1484258	hsa-miR-4283	CLIP-seq
MIRT1484259	hsa-miR-4306	CLIP-seq
MIRT1484260	hsa-miR-432	CLIP-seq
MIRT1484261	hsa-miR-4430	CLIP-seq
MIRT2145781	hsa-miR-4471	CLIP-seq
MIRT1484265	hsa-miR-4531	CLIP-seq
MIRT1484267	hsa-miR-4644	CLIP-seq
MIRT2145782	hsa-miR-4664-3p	CLIP-seq
MIRT1484270	hsa-miR-4716-3p	CLIP-seq
MIRT2145783	hsa-miR-4766-3p	CLIP-seq
MIRT1484275	hsa-miR-485-5p	CLIP-seq
MIRT1484277	hsa-miR-513a-5p	CLIP-seq
MIRT2145784	hsa-miR-548p	CLIP-seq
MIRT1484278	hsa-miR-582-3p	CLIP-seq
MIRT1484279	hsa-miR-603	CLIP-seq
MIRT1484280	hsa-miR-620	CLIP-seq
MIRT2145785	hsa-miR-671-3p	CLIP-seq
MIRT1484282	hsa-miR-890	CLIP-seq
MIRT1484244	hsa-miR-3135b	CLIP-seq
MIRT1484249	hsa-miR-3652	CLIP-seq
MIRT1484253	hsa-miR-377	CLIP-seq
MIRT1484261	hsa-miR-4430	CLIP-seq
MIRT1484262	hsa-miR-4446-3p	CLIP-seq
MIRT1484263	hsa-miR-4492	CLIP-seq
MIRT1484264	hsa-miR-4498	CLIP-seq
MIRT1484278	hsa-miR-582-3p	CLIP-seq
MIRT1484279	hsa-miR-603	CLIP-seq
MIRT1484281	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NPAS3	Unknown	21709683
REST	Unknown	19118055

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0002021	Process	Response to dietary excess	IEA
GO:0005179	Function	Hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15706611
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0006091	Process	Generation of precursor metabolites and energy	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0009409	Process	Response to cold	IEA
GO:0019953	Process	Sexual reproduction	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030133	Component	Transport vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	17440014
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0033500	Process	Carbohydrate homeostasis	IBA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IBA
GO:0051591	Process	Response to cAMP	IEP	10381005

Other IDs

• MIM: 602186
• HGNC: 12684
• e!Ensembl: ENSG00000128564

Protein

• UniProt ID: O15240
• Protein name: Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide-1 (NERP-1); Neuroendocrine regulatory peptide-2 (NERP-2); VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-62; Antimicrobial peptide VGF[554-577]]
• Protein function: [Neurosecretory protein VGF]: Secreted polyprotein that is packaged and proteolytically processed by prohormone convertases PCSK1 and PCSK2 in a cell-type-specific manner (By similarity). VGF and peptides derived from its processing play many ro
• PDB: 7D13, 7D16, 8H0G, 8H0U
• Tissue specificity: TISSUE SPECIFICITY: Central and peripheral nervous systems, synthesized exclusively in neuronal and neuroendocrine cells. {ECO:0000269|PubMed:19194657}.
• Sequence:

  MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVR
  GARNSEPQDEGELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVR
  SQTHSLPAPESPEPAAPPRPQTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQET
  AAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPPAPSQFQARMPDSGP
  LPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKARRPESALLGGSEAGERLLQQG
  LAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRGLQEAAEERES
  AREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS
  QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKR
  KRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPP
  GPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQ
  EELENYIEHVLLRRP

• Sequence length: 615

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28381546		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22046305, 26270474, 30578620, 32301581, 36776048	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26142708	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32366888, 36912488	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	16481598		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18432310, 21151573, 27737014, 30618638, 30656593		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32174778	Inhibit	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	24934694	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30690892		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	33893496	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20631166		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20631166, 24934694		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24934694	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24830820		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	21838886	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24927296		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19228724, 24277232, 24927296	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24830820	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24830820		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28381546		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24086249		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25921200		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33413474	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	30575991		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	18815270, 18983874, 20631166, 22990943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	20631166, 22990943, 28680036, 30504797		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	25675362, 28024880		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22808091	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25675362, 28024880		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22808091, 26337083	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	27088090		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24277232	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32576262, 34838088	Associate	★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	20805684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	29625067		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29625067		★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	34360799	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31547145		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	24934694	Inhibit	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31547145		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	32552841	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29209432	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18923405, 28635540, 30504797, 30575991, 31037515		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24277232, 24927296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28381546		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24086249		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31682594		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24830820		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28381546		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28680036		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	18815270, 18983874, 20631166, 22990943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	20631166, 22990943, 28680036, 30504797		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	20631166, 24934694, 28287464		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29370833, 31305322		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20164831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	20164831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	9478934		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28381546, 29209432, 29625067		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24646654		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26142708	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31305322		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25675362, 26337083, 27088090, 28024880		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26337083	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24086249		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24086249	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31713727		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33481347, 35732154	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31682594		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31682594, 35466393	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17684500, 28626390, 28680036, 29653412, 30460640, 31037515		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	22068818	Associate	★☆☆☆☆ Found in Text Mining only
Social Anhedonia	Social Anhedonia	BEFREE	24934694		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32588760	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18923405, 30575991, 31037515		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24830820	Associate	★☆☆☆☆ Found in Text Mining only