Gene Gene information from NCBI Gene database.
Entrez ID 7424
Gene name Vascular endothelial growth factor C
Gene symbol VEGFC
Synonyms (NCBI Gene)
Flt4-LLMPH1DLMPHM4VRP
Chromosome 4
Chromosome location 4q34.3
Summary The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs587777566 ->AA Pathogenic Frameshift variant, coding sequence variant
rs587777567 G>A Pathogenic Stop gained, coding sequence variant
rs1057524647 T>A Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
102
miRTarBase ID miRNA Experiments Reference
MIRT021989 hsa-miR-128-3p Microarray 17612493
MIRT054253 hsa-miR-27b-3p ELISAImmunofluorescenceMicroarrayLuciferase reporter assayQRTPCRWestern blot 23593282
MIRT021989 hsa-miR-128-3p SK-MES-1 25001183
MIRT021989 hsa-miR-128-3p SK-MES-1 25001183
MIRT631912 hsa-miR-508-5p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
RUNX2 Activation 22641097
SIX1 Activation 22466647
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
52
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001666 Process Response to hypoxia IBA
GO:0002040 Process Sprouting angiogenesis IBA
GO:0002052 Process Positive regulation of neuroblast proliferation IEA
GO:0005515 Function Protein binding IPI 20145116, 21130043, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601528 12682 ENSG00000150630
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49767
Protein name Vascular endothelial growth factor C (VEGF-C) (Flt4 ligand) (Flt4-L) (Vascular endothelial growth factor-related protein) (VRP)
Protein function Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems
PDB 2X1W , 2X1X , 4BSK , 6TJT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00341 PDGF 131 211 PDGF/VEGF domain Domain
PF03128 CXCXC 283 295 CXCXC repeat Repeat
PF03128 CXCXC 308 319 CXCXC repeat Repeat
PF03128 CXCXC 331 343 CXCXC repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in the spleen (PubMed:8700872, PubMed:9247316). Expressed in the lymph node, thymus, appendix and bone marrow (PubMed:9247316). Expressed in the heart, placenta, skeletal muscle, ovary and small intestine (PubMed:8617204, Pub
Sequence
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
LSKTLFEITVPLSQGPKPVTISFANHTSCRC
MSKLDVYRQVHSIIRRSLPATLPQCQAAN
KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS
Sequence length 419
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
  Platelet degranulation
VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Lymphatic malformation 4 Pathogenic rs587777566, rs587777567 RCV000128848
RCV000128849
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Squamous cell carcinoma of the head and neck Pathogenic rs1057524647 RCV005898141
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL PRIMARY LYMPHEDEMA OF GORDON Disgenet, Orphanet
Disgenet, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 21732038
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 29345176, 30185550
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 12168824, 14744769, 15173661, 16116610
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 10873096, 14744769, 17970036, 27461624
★☆☆☆☆
Found in Text Mining only
Adenoid Cystic Carcinoma Adenocarcinoma BEFREE 25797250
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 12754739, 28347226
★☆☆☆☆
Found in Text Mining only
Adult Acute Myeloblastic Leukemia Myeloblastic Leukemia BEFREE 20522712, 29345176, 29544089
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 25098430
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 16842779
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum BEFREE 25797250
★☆☆☆☆
Found in Text Mining only