Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7417
Gene name	Voltage dependent anion channel 2
Gene symbol	VDAC2
Synonyms (NCBI Gene)	POR
Chromosome	10
Chromosome location	10q22.2
Summary	This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in

250

Show/Hide all (250)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021858	hsa-miR-132-3p	Microarray	17612493
MIRT048258	hsa-miR-196a-5p	CLASH	23622248
MIRT046413	hsa-miR-15b-5p	CLASH	23622248
MIRT044736	hsa-miR-320a	CLASH	23622248
MIRT615410	hsa-miR-4512	HITS-CLIP	23824327
MIRT615409	hsa-miR-3918	HITS-CLIP	23824327
MIRT615408	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT615407	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT615406	hsa-miR-1913	HITS-CLIP	23824327
MIRT615405	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT615404	hsa-miR-6132	HITS-CLIP	23824327
MIRT615403	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT615402	hsa-miR-4313	HITS-CLIP	23824327
MIRT615401	hsa-miR-4312	HITS-CLIP	23824327
MIRT615400	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT615399	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT615398	hsa-miR-3909	HITS-CLIP	23824327
MIRT615397	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT615396	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615395	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT615394	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT615410	hsa-miR-4512	HITS-CLIP	23824327
MIRT615409	hsa-miR-3918	HITS-CLIP	23824327
MIRT615408	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT615407	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT615406	hsa-miR-1913	HITS-CLIP	23824327
MIRT615405	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT615404	hsa-miR-6132	HITS-CLIP	23824327
MIRT615403	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT615402	hsa-miR-4313	HITS-CLIP	23824327
MIRT615401	hsa-miR-4312	HITS-CLIP	23824327
MIRT615400	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT615399	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT615398	hsa-miR-3909	HITS-CLIP	23824327
MIRT615397	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT615396	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615395	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT615394	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT615410	hsa-miR-4512	HITS-CLIP	23824327
MIRT615409	hsa-miR-3918	HITS-CLIP	23824327
MIRT615408	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT615407	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT615406	hsa-miR-1913	HITS-CLIP	23824327
MIRT615405	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT615404	hsa-miR-6132	HITS-CLIP	23824327
MIRT615403	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT615402	hsa-miR-4313	HITS-CLIP	23824327
MIRT615401	hsa-miR-4312	HITS-CLIP	23824327
MIRT615400	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT615399	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT615398	hsa-miR-3909	HITS-CLIP	23824327
MIRT615397	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT615396	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615395	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT615394	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT572960	hsa-miR-548n	PAR-CLIP	20371350
MIRT572959	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT572958	hsa-miR-548ab	PAR-CLIP	20371350
MIRT572957	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT572955	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT572956	hsa-miR-548ak	PAR-CLIP	20371350
MIRT572954	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT572953	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT572952	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT572951	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT572950	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT572949	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT572948	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT572947	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT572946	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT572945	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT572943	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT572944	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT572942	hsa-miR-548i	PAR-CLIP	20371350
MIRT572941	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT572940	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT572939	hsa-miR-548w	PAR-CLIP	20371350
MIRT572938	hsa-miR-548y	PAR-CLIP	20371350
MIRT572937	hsa-miR-559	PAR-CLIP	20371350
MIRT572936	hsa-miR-5197-5p	PAR-CLIP	20371350
MIRT572935	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT572934	hsa-miR-204-3p	PAR-CLIP	20371350
MIRT572933	hsa-miR-4646-5p	PAR-CLIP	20371350
MIRT572932	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT572931	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT572930	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT572929	hsa-miR-4314	PAR-CLIP	20371350
MIRT127283	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT127293	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT127282	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT615410	hsa-miR-4512	HITS-CLIP	23824327
MIRT615409	hsa-miR-3918	HITS-CLIP	23824327
MIRT615408	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT615407	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT615406	hsa-miR-1913	HITS-CLIP	23824327
MIRT615405	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT615404	hsa-miR-6132	HITS-CLIP	23824327
MIRT615403	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT615402	hsa-miR-4313	HITS-CLIP	23824327
MIRT615401	hsa-miR-4312	HITS-CLIP	23824327
MIRT615400	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT615399	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT615398	hsa-miR-3909	HITS-CLIP	23824327
MIRT615397	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT615396	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615395	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT615394	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT615410	hsa-miR-4512	HITS-CLIP	23824327
MIRT615409	hsa-miR-3918	HITS-CLIP	23824327
MIRT615408	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT615407	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT615406	hsa-miR-1913	HITS-CLIP	23824327
MIRT615405	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT615404	hsa-miR-6132	HITS-CLIP	23824327
MIRT615403	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT615402	hsa-miR-4313	HITS-CLIP	23824327
MIRT615401	hsa-miR-4312	HITS-CLIP	23824327
MIRT615400	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT615399	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT615398	hsa-miR-3909	HITS-CLIP	23824327
MIRT615397	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT615396	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615395	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT615394	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT615410	hsa-miR-4512	HITS-CLIP	23824327
MIRT615409	hsa-miR-3918	HITS-CLIP	23824327
MIRT615408	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT615407	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT615406	hsa-miR-1913	HITS-CLIP	23824327
MIRT615405	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT615404	hsa-miR-6132	HITS-CLIP	23824327
MIRT615403	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT615402	hsa-miR-4313	HITS-CLIP	23824327
MIRT615401	hsa-miR-4312	HITS-CLIP	23824327
MIRT615400	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT615399	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT615398	hsa-miR-3909	HITS-CLIP	23824327
MIRT615397	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT615396	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT615395	hsa-miR-676-3p	HITS-CLIP	23824327
MIRT615394	hsa-miR-2355-3p	HITS-CLIP	23824327
MIRT572960	hsa-miR-548n	PAR-CLIP	20371350
MIRT572959	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT572958	hsa-miR-548ab	PAR-CLIP	20371350
MIRT572957	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT572955	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT572956	hsa-miR-548ak	PAR-CLIP	20371350
MIRT572954	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT572953	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT572952	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT572951	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT572950	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT572949	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT572948	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT572947	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT572946	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT572945	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT572943	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT572944	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT572942	hsa-miR-548i	PAR-CLIP	20371350
MIRT572941	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT572940	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT572939	hsa-miR-548w	PAR-CLIP	20371350
MIRT572938	hsa-miR-548y	PAR-CLIP	20371350
MIRT572937	hsa-miR-559	PAR-CLIP	20371350
MIRT572936	hsa-miR-5197-5p	PAR-CLIP	20371350
MIRT572935	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT572934	hsa-miR-204-3p	PAR-CLIP	20371350
MIRT572933	hsa-miR-4646-5p	PAR-CLIP	20371350
MIRT572932	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT572931	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT572930	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT572929	hsa-miR-4314	PAR-CLIP	20371350
MIRT1483651	hsa-miR-25	CLIP-seq
MIRT1483652	hsa-miR-32	CLIP-seq
MIRT1483653	hsa-miR-363	CLIP-seq
MIRT1483654	hsa-miR-367	CLIP-seq
MIRT1483655	hsa-miR-4328	CLIP-seq
MIRT1483656	hsa-miR-92a	CLIP-seq
MIRT1483657	hsa-miR-92b	CLIP-seq
MIRT1483658	hsa-miR-548h	CLIP-seq
MIRT1483659	hsa-miR-548j	CLIP-seq
MIRT1483658	hsa-miR-548h	CLIP-seq
MIRT1483659	hsa-miR-548j	CLIP-seq
MIRT2145584	hsa-miR-132	CLIP-seq
MIRT2145585	hsa-miR-138	CLIP-seq
MIRT2145586	hsa-miR-194	CLIP-seq
MIRT2145587	hsa-miR-2052	CLIP-seq
MIRT2145588	hsa-miR-212	CLIP-seq
MIRT2145589	hsa-miR-3192	CLIP-seq
MIRT2145590	hsa-miR-3688-3p	CLIP-seq
MIRT2145591	hsa-miR-370	CLIP-seq
MIRT2145592	hsa-miR-4263	CLIP-seq
MIRT2145593	hsa-miR-4307	CLIP-seq
MIRT2145594	hsa-miR-4509	CLIP-seq
MIRT2145595	hsa-miR-4744	CLIP-seq
MIRT2145596	hsa-miR-4799-5p	CLIP-seq
MIRT2145597	hsa-miR-4803	CLIP-seq
MIRT2145598	hsa-miR-495	CLIP-seq
MIRT1483658	hsa-miR-548h	CLIP-seq
MIRT1483659	hsa-miR-548j	CLIP-seq
MIRT2145599	hsa-miR-576-5p	CLIP-seq
MIRT2145600	hsa-miR-596	CLIP-seq
MIRT2145601	hsa-miR-656	CLIP-seq
MIRT2366032	hsa-miR-1275	CLIP-seq
MIRT2145585	hsa-miR-138	CLIP-seq
MIRT2145587	hsa-miR-2052	CLIP-seq
MIRT2366033	hsa-miR-3148	CLIP-seq
MIRT2145591	hsa-miR-370	CLIP-seq
MIRT1483655	hsa-miR-4328	CLIP-seq
MIRT2366034	hsa-miR-4525	CLIP-seq
MIRT2366035	hsa-miR-4665-5p	CLIP-seq
MIRT2366036	hsa-miR-4668-5p	CLIP-seq
MIRT2366037	hsa-miR-4723-5p	CLIP-seq
MIRT2366038	hsa-miR-4778-3p	CLIP-seq
MIRT2145598	hsa-miR-495	CLIP-seq
MIRT2366039	hsa-miR-548m	CLIP-seq
MIRT2145600	hsa-miR-596	CLIP-seq
MIRT2366040	hsa-miR-625	CLIP-seq
MIRT2366041	hsa-miR-635	CLIP-seq
MIRT2659540	hsa-miR-103a	CLIP-seq
MIRT2659541	hsa-miR-107	CLIP-seq
MIRT2659542	hsa-miR-1184	CLIP-seq
MIRT2659543	hsa-miR-1205	CLIP-seq
MIRT2659544	hsa-miR-1286	CLIP-seq
MIRT2659545	hsa-miR-1288	CLIP-seq
MIRT2145584	hsa-miR-132	CLIP-seq
MIRT2659546	hsa-miR-134	CLIP-seq
MIRT2145588	hsa-miR-212	CLIP-seq
MIRT2659547	hsa-miR-28-3p	CLIP-seq
MIRT2659548	hsa-miR-3118	CLIP-seq
MIRT2659549	hsa-miR-3132	CLIP-seq
MIRT2659550	hsa-miR-3133	CLIP-seq
MIRT2659551	hsa-miR-3169	CLIP-seq
MIRT2659552	hsa-miR-4310	CLIP-seq
MIRT1483655	hsa-miR-4328	CLIP-seq
MIRT2659553	hsa-miR-4418	CLIP-seq
MIRT2659554	hsa-miR-4511	CLIP-seq
MIRT2659555	hsa-miR-4528	CLIP-seq
MIRT2659556	hsa-miR-4722-5p	CLIP-seq
MIRT2145596	hsa-miR-4799-5p	CLIP-seq
MIRT2145598	hsa-miR-495	CLIP-seq
MIRT2659557	hsa-miR-509-3-5p	CLIP-seq
MIRT2659558	hsa-miR-509-5p	CLIP-seq
MIRT2659559	hsa-miR-541	CLIP-seq
MIRT2366039	hsa-miR-548m	CLIP-seq
MIRT2659560	hsa-miR-577	CLIP-seq
MIRT2659561	hsa-miR-654-5p	CLIP-seq
MIRT2145584	hsa-miR-132	CLIP-seq
MIRT2145588	hsa-miR-212	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001669	Component	Acrosomal vesicle	IDA	23355646
GO:0005244	Function	Voltage-gated monoatomic ion channel activity	IDA	8420959
GO:0005515	Function	Protein binding	IPI	15082785, 17500595, 23355646, 26618866, 29128334, 30021884, 32814053, 35156780, 35271311, 36012204
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	7539795
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006820	Process	Monoatomic anion transport	IDA	8420959
GO:0006869	Process	Lipid transport	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IMP	23355646
GO:0008142	Function	Oxysterol binding	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	IBA
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	IDA	38065946
GO:0008308	Function	Voltage-gated monoatomic anion channel activity	IEA
GO:0015288	Function	Porin activity	IEA
GO:0015485	Function	Cholesterol binding	IDA	31015432
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0017121	Process	Plasma membrane phospholipid scrambling	IEA
GO:0017128	Function	Phospholipid scramblase activity	IDA	38065946
GO:0031210	Function	Phosphatidylcholine binding	IDA	31015432
GO:0031966	Component	Mitochondrial membrane	IDA	31015432
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0045121	Component	Membrane raft	IDA	25204797
GO:0045332	Process	Phospholipid translocation	IDA	38065946
GO:0046930	Component	Pore complex	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0097001	Function	Ceramide binding	IDA	31015432
GO:0097225	Component	Sperm midpiece	ISS
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IMP	31015432
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA
GO:1990542	Process	Mitochondrial transmembrane transport	IDA	38065946

MIM	HGNC	e!Ensembl
193245	12672	ENSG00000165637

P45880

Protein name

Non-selective voltage-gated ion channel VDAC2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2)

Protein function

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane (PubMed:8420959). The channel adopts an open conformation at zero mV and a closed conformation

PDB

9EIH , 9EII , 9EIJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01459	Porin_3	14 → 287	Eukaryotic porin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level) (PubMed:27641616). Expressed in all tissues examined (PubMed:8420959). {ECO:0000269|PubMed:27641616, ECO:0000269|PubMed:8420959}.

Sequence

MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNT
DTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGK
KSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNF
AVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP
TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA

Sequence length

294

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Ferroptosis Necroptosis Cellular senescence Neutrophil extracellular trap formation NOD-like receptor signaling pathway Cholesterol metabolism Alzheimer disease Parkinson disease Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Human T-cell leukemia virus 1 infection Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE COMBINED IMMUNODEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe combined immunodeficiency disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (184)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29617211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10782892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	8496319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	8496319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	19884324, 21190981, 23365120, 27376429, 32060549, 32994263, 33666875, 34823514, 36518257, 38136599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenogenital Syndrome	Adrenogenital Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	21987461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	BEFREE	16998238, 18853185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ambiguous genitalia, female	Ambiguous Genitalia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11432979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30250190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome Phenotype	Antley-Bixler Syndrome	CTD_human_DG	14758361, 15220035, 16906539, 27496950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome Phenotype	Antley-Bixler Syndrome	LHGDN	16467261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome Phenotype	Antley-Bixler Syndrome	BEFREE	26969897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	CLINVAR_DG	14758361, 15483095, 19837910, 20124576, 20732302, 20940534, 21741353, 22162478, 28841001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	UNIPROT_DG	14758361, 15220035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	GENOMICS_ENGLAND_DG	14758361, 16470797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	CTD_human_DG	14758361, 15220035, 16906539, 27496950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	BEFREE	15793702, 19621255, 23092891, 29289577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome with Disordered Steroidogenesis	Antley-Bixler Syndrome	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTLEY-BIXLER SYNDROME WITH GENITAL ANOMALIES AND DISORDERED STEROIDOGENESIS	Antley-Bixler Syndrome With Genital Anomalies And Disordered Steroidogenesis	GENOMICS_ENGLAND_DG	12116245, 14758361, 16470797		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTLEY-BIXLER SYNDROME WITH GENITAL ANOMALIES AND DISORDERED STEROIDOGENESIS	Antley-Bixler Syndrome With Genital Anomalies And Disordered Steroidogenesis	UNIPROT_DG	14758361, 15264278, 15483095		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTLEY-BIXLER SYNDROME WITH GENITAL ANOMALIES AND DISORDERED STEROIDOGENESIS	Antley-Bixler Syndrome With Genital Anomalies And Disordered Steroidogenesis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANTLEY-BIXLER SYNDROME WITH GENITAL ANOMALIES AND DISORDERED STEROIDOGENESIS	Antley-Bixler Syndrome With Genital Anomalies And Disordered Steroidogenesis	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome, Autosomal Dominant	Antley-Bixler Syndrome	CTD_human_DG	14758361, 15220035, 16906539, 27496950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antley-Bixler Syndrome, Autosomal Dominant	Antley-Bixler Syndrome	BEFREE	15483095, 15793702, 18455494, 23295302, 26969897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnodactyly	Arachnodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arnold Chiari Malformation	Arnold-Chiari malformation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	20809416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	27892527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29648957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atresia of vagina	Atresia Of Vagina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28082004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	17893921		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22705850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29102659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	8631603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14583491, 17440066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchomalacia	Bronchomalacia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29323757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35164791, 36028814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15746946, 22378505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36445063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37416771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27892527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal synostosis	Carpal synostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30208850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30327144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26108676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	36518257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	LHGDN	15220035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	CTD_human_DG	18559916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	20639616, 20732302, 20849814, 23878291, 27376429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	19884324, 33666875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to cytochrome P450 oxidoreductase deficiency	Congenital adrenal hyperplasia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	16036478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronal craniosynostosis	Coronal craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30186434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30186434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30186434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	LHGDN	16467261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	21082653, 29392564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	8496319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of testosterone biosynthesis	Deficiency Of Testosterone Biosynthesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24921414, 28712959, 30186434, 31672500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24921414, 28712959, 30186434, 31672500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31466840, 31672500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	19634143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorder of Sex Development 46 XY	46, xy disorder of sex development	Pubtator	20410220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	15793702, 27376429, 27496950, 32994263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectopic adrenal gland	Ectopic adrenal gland	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32829673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enlarged polycystic ovaries	Enlarged polycystic ovaries	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	17893921		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	17893921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28203294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28203294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Female sexual dysfunction	Female sexual dysfunction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	30899261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25854377, 30250190		★★★★★ ★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	CTD_human_DG	9766669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37416771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	21973081, 31561354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	31561354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Horseshoe Kidney	Horseshoe Kidney	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	29084037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25521355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30767071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25521355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32994263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22842492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy of clitoris	Hypertrophy Of Clitoris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	31534089	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28656666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	21190981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of vagina	Hypoplasia Of Vagina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	23878291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias, perineal	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18270456, 24196959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27440375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	27806320, 36518257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	27806320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31584351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28097649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30208850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	10782892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngomalacia	Laryngomalacia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	21987461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disorders	Learning Disorders	CTD_human_DG	21987461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disturbance	Learning Disorders	CTD_human_DG	21987461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24642534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31031855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	8313365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Male Pseudohermaphroditism	Male Pseudohermaphroditism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14583491, 17440066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28203294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15746946, 22378505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29323757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	8631603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30327144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17440066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22705850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21222216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	38136599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37416771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	27440375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	24766134, 25854377, 30478310, 9383053, 9467596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	19634143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	21190981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36941558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32641986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	37126018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27440375, 31587047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature adrenarche	Premature adrenarche	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28069826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Radioulnar Synostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ramer Ladda syndrome	Ramer Ladda Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud Disease	BEFREE	31210062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	27432486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37416771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31756416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	21840928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26297733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stenosis of external auditory canal	Stenosis Of External Auditory Canal	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Synostotic Posterior Plagiocephaly	Synostotic Posterior Plagiocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	28385642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tarsal Coalition	Tarsal Coalition	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25617717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	27496950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30110125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	21070833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	27771299, 28104427, 29788845, 31059670, 31183772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicovaginal Fistula	Vesicovaginal Fistula	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	32077592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

VDAC2 (voltage dependent anion channel 2)