Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7411
Gene name	VHL binding protein 1
Gene symbol	VBP1
Synonyms (NCBI Gene)	HIBBJ46PFD3PFDN3VBP-1
Chromosome	X
Chromosome location	Xq28
Summary	The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclea

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020511	hsa-miR-155-5p	Proteomics	18668040
MIRT048922	hsa-miR-92a-3p	CLASH	23622248
MIRT044083	hsa-miR-361-5p	CLASH	23622248
MIRT695623	hsa-miR-548at-5p	HITS-CLIP	23313552
MIRT695622	hsa-miR-649	HITS-CLIP	23313552
MIRT695621	hsa-miR-4662a-3p	HITS-CLIP	23313552
MIRT695620	hsa-miR-541-5p	HITS-CLIP	23313552
MIRT695619	hsa-miR-3936	HITS-CLIP	23313552
MIRT695618	hsa-miR-3973	HITS-CLIP	23313552
MIRT695617	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT695616	hsa-miR-520h	HITS-CLIP	23313552
MIRT695615	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT695614	hsa-miR-503-3p	HITS-CLIP	23313552
MIRT695613	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT695612	hsa-miR-3658	HITS-CLIP	23313552
MIRT695623	hsa-miR-548at-5p	HITS-CLIP	23313552
MIRT695622	hsa-miR-649	HITS-CLIP	23313552
MIRT695621	hsa-miR-4662a-3p	HITS-CLIP	23313552
MIRT695620	hsa-miR-541-5p	HITS-CLIP	23313552
MIRT695619	hsa-miR-3936	HITS-CLIP	23313552
MIRT695618	hsa-miR-3973	HITS-CLIP	23313552
MIRT695617	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT695616	hsa-miR-520h	HITS-CLIP	23313552
MIRT695615	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT695614	hsa-miR-503-3p	HITS-CLIP	23313552
MIRT695613	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT695612	hsa-miR-3658	HITS-CLIP	23313552
MIRT1483200	hsa-miR-129-3p	CLIP-seq
MIRT1483201	hsa-miR-3651	CLIP-seq
MIRT1483202	hsa-miR-4687-5p	CLIP-seq
MIRT1483203	hsa-miR-633	CLIP-seq
MIRT2145499	hsa-miR-3662	CLIP-seq
MIRT2365776	hsa-miR-1208	CLIP-seq
MIRT2365777	hsa-miR-224	CLIP-seq
MIRT2365778	hsa-miR-325	CLIP-seq
MIRT2365779	hsa-miR-3692	CLIP-seq
MIRT2365780	hsa-miR-3923	CLIP-seq
MIRT2365781	hsa-miR-4307	CLIP-seq
MIRT2365782	hsa-miR-4503	CLIP-seq
MIRT2365783	hsa-miR-452	CLIP-seq
MIRT2365784	hsa-miR-4676-3p	CLIP-seq
MIRT2365785	hsa-miR-4729	CLIP-seq
MIRT2365786	hsa-miR-4738-5p	CLIP-seq
MIRT2365787	hsa-miR-4742-3p	CLIP-seq
MIRT2396807	hsa-miR-3200-5p	CLIP-seq
MIRT2396808	hsa-miR-4325	CLIP-seq
MIRT2396809	hsa-miR-4649-3p	CLIP-seq
MIRT2396810	hsa-miR-4793-3p	CLIP-seq
MIRT2434514	hsa-miR-1256	CLIP-seq
MIRT2434515	hsa-miR-4287	CLIP-seq
MIRT2434516	hsa-miR-4642	CLIP-seq
MIRT2434517	hsa-miR-4685-3p	CLIP-seq
MIRT2434518	hsa-miR-4781-3p	CLIP-seq
MIRT2434519	hsa-miR-518a-5p	CLIP-seq
MIRT2434520	hsa-miR-527	CLIP-seq
MIRT2659344	hsa-miR-1290	CLIP-seq
MIRT2659345	hsa-miR-181a	CLIP-seq
MIRT2659346	hsa-miR-181b	CLIP-seq
MIRT2659347	hsa-miR-181c	CLIP-seq
MIRT2659348	hsa-miR-181d	CLIP-seq
MIRT2659349	hsa-miR-299-5p	CLIP-seq
MIRT2659350	hsa-miR-3120-5p	CLIP-seq
MIRT2659351	hsa-miR-3129-3p	CLIP-seq
MIRT2659352	hsa-miR-3148	CLIP-seq
MIRT2659353	hsa-miR-3163	CLIP-seq
MIRT2659354	hsa-miR-3190	CLIP-seq
MIRT2365778	hsa-miR-325	CLIP-seq
MIRT2659355	hsa-miR-340	CLIP-seq
MIRT2145499	hsa-miR-3662	CLIP-seq
MIRT2365779	hsa-miR-3692	CLIP-seq
MIRT2659356	hsa-miR-374c	CLIP-seq
MIRT2365780	hsa-miR-3923	CLIP-seq
MIRT2659357	hsa-miR-4251	CLIP-seq
MIRT2659358	hsa-miR-4262	CLIP-seq
MIRT2659359	hsa-miR-4272	CLIP-seq
MIRT2659360	hsa-miR-4282	CLIP-seq
MIRT2365781	hsa-miR-4307	CLIP-seq
MIRT2659361	hsa-miR-4436b-5p	CLIP-seq
MIRT2659362	hsa-miR-4491	CLIP-seq
MIRT2659363	hsa-miR-4657	CLIP-seq
MIRT2659364	hsa-miR-4663	CLIP-seq
MIRT2659365	hsa-miR-4684-5p	CLIP-seq
MIRT2659366	hsa-miR-4694-5p	CLIP-seq
MIRT2365785	hsa-miR-4729	CLIP-seq
MIRT2659367	hsa-miR-4735-5p	CLIP-seq
MIRT2659368	hsa-miR-4738-3p	CLIP-seq
MIRT2365786	hsa-miR-4738-5p	CLIP-seq
MIRT2365787	hsa-miR-4742-3p	CLIP-seq
MIRT2659369	hsa-miR-4742-5p	CLIP-seq
MIRT2659370	hsa-miR-4751	CLIP-seq
MIRT2659371	hsa-miR-4775	CLIP-seq
MIRT2659372	hsa-miR-505	CLIP-seq
MIRT2659373	hsa-miR-520d-5p	CLIP-seq
MIRT2659374	hsa-miR-520g	CLIP-seq
MIRT2659375	hsa-miR-522	CLIP-seq
MIRT2659376	hsa-miR-524-5p	CLIP-seq
MIRT2659377	hsa-miR-539	CLIP-seq
MIRT2659378	hsa-miR-543	CLIP-seq
MIRT2659379	hsa-miR-548c-3p	CLIP-seq
MIRT2659380	hsa-miR-548g	CLIP-seq
MIRT2659381	hsa-miR-590-3p	CLIP-seq
MIRT2659382	hsa-miR-628-5p	CLIP-seq
MIRT2659383	hsa-miR-655	CLIP-seq
MIRT2659384	hsa-miR-942	CLIP-seq
MIRT2659344	hsa-miR-1290	CLIP-seq
MIRT2659345	hsa-miR-181a	CLIP-seq
MIRT2659346	hsa-miR-181b	CLIP-seq
MIRT2659347	hsa-miR-181c	CLIP-seq
MIRT2659348	hsa-miR-181d	CLIP-seq
MIRT2659350	hsa-miR-3120-5p	CLIP-seq
MIRT2659351	hsa-miR-3129-3p	CLIP-seq
MIRT2659352	hsa-miR-3148	CLIP-seq
MIRT2659353	hsa-miR-3163	CLIP-seq
MIRT2659354	hsa-miR-3190	CLIP-seq
MIRT2365778	hsa-miR-325	CLIP-seq
MIRT2659355	hsa-miR-340	CLIP-seq
MIRT2694957	hsa-miR-3613-3p	CLIP-seq
MIRT2145499	hsa-miR-3662	CLIP-seq
MIRT2365779	hsa-miR-3692	CLIP-seq
MIRT2659356	hsa-miR-374c	CLIP-seq
MIRT2365780	hsa-miR-3923	CLIP-seq
MIRT2659357	hsa-miR-4251	CLIP-seq
MIRT2659358	hsa-miR-4262	CLIP-seq
MIRT2659359	hsa-miR-4272	CLIP-seq
MIRT2659360	hsa-miR-4282	CLIP-seq
MIRT2365781	hsa-miR-4307	CLIP-seq
MIRT2659361	hsa-miR-4436b-5p	CLIP-seq
MIRT2659362	hsa-miR-4491	CLIP-seq
MIRT2659363	hsa-miR-4657	CLIP-seq
MIRT2659364	hsa-miR-4663	CLIP-seq
MIRT2659365	hsa-miR-4684-5p	CLIP-seq
MIRT2659366	hsa-miR-4694-5p	CLIP-seq
MIRT2365785	hsa-miR-4729	CLIP-seq
MIRT2659367	hsa-miR-4735-5p	CLIP-seq
MIRT2659368	hsa-miR-4738-3p	CLIP-seq
MIRT2365786	hsa-miR-4738-5p	CLIP-seq
MIRT2365787	hsa-miR-4742-3p	CLIP-seq
MIRT2659369	hsa-miR-4742-5p	CLIP-seq
MIRT2659370	hsa-miR-4751	CLIP-seq
MIRT2659371	hsa-miR-4775	CLIP-seq
MIRT2659372	hsa-miR-505	CLIP-seq
MIRT2659373	hsa-miR-520d-5p	CLIP-seq
MIRT2659374	hsa-miR-520g	CLIP-seq
MIRT2659375	hsa-miR-522	CLIP-seq
MIRT2659376	hsa-miR-524-5p	CLIP-seq
MIRT2659377	hsa-miR-539	CLIP-seq
MIRT2659378	hsa-miR-543	CLIP-seq
MIRT2659379	hsa-miR-548c-3p	CLIP-seq
MIRT2659380	hsa-miR-548g	CLIP-seq
MIRT2659381	hsa-miR-590-3p	CLIP-seq
MIRT2659382	hsa-miR-628-5p	CLIP-seq
MIRT2659383	hsa-miR-655	CLIP-seq
MIRT2659384	hsa-miR-942	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IDA	23614719
GO:0005515	Function	Protein binding	IPI	17698809, 22190034, 25416956, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8674032
GO:0005829	Component	Cytosol	IDA
GO:0006457	Process	Protein folding	IDA	30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	NAS	32699605
GO:0007017	Process	Microtubule-based process	IBA
GO:0007021	Process	Tubulin complex assembly	IBA
GO:0015631	Function	Tubulin binding	IBA
GO:0016272	Component	Prefoldin complex	IBA
GO:0016272	Component	Prefoldin complex	IDA	23614719, 30955883
GO:0016272	Component	Prefoldin complex	IEA
GO:0016272	Component	Prefoldin complex	NAS	32699605
GO:0032991	Component	Protein-containing complex	IEA
GO:0051082	Function	Unfolded protein binding	IDA	30955883
GO:1905907	Process	Negative regulation of amyloid fibril formation	IDA	23614719

MIM	HGNC	e!Ensembl
300133	12662	ENSG00000155959

P61758

Protein name

Prefoldin subunit 3 (HIBBJ46) (von Hippel-Lindau-binding protein 1) (VBP-1) (VHL-binding protein 1)

Protein function

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. {ECO:0000269|Pub

PDB

6NR8 , 6NR9 , 6NRB , 6NRC , 6NRD , 7WU7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02996	Prefoldin	60 → 182	Prefoldin subunit	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKY
KFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPT
DKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVY
NWDVKRRNKDDSTKNKA

Sequence length

197

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Ependymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18315953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33137104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10441001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36076300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18315953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	21685710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18315953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29121446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	15572213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	8674032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	14729622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31957800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	14612903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	18315953, 8674032		★★★★★ ★☆☆☆☆ Found in Text Mining only

VBP1 (VHL binding protein 1)