Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7408
Gene name	Vasodilator stimulated phosphoprotein
Gene symbol	VASP
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.32
Summary	Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the

195

Show/Hide all (195)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006292	hsa-miR-610	Luciferase reporter assayWestern blot	22189055
MIRT006292	hsa-miR-610	Luciferase reporter assayWestern blot	22189055
MIRT006292	hsa-miR-610	Luciferase reporter assayWestern blot	22189055
MIRT006292	hsa-miR-610	Luciferase reporter assayWestern blot	22189055
MIRT006292	hsa-miR-610	Luciferase reporter assayWestern blot	22189055
MIRT006292	hsa-miR-610	Luciferase reporter assayWestern blot	22189055
MIRT016406	hsa-miR-193b-3p	Proteomics	21512034
MIRT023600	hsa-miR-1-3p	Proteomics	18668040
MIRT038256	hsa-miR-330-5p	CLASH	23622248
MIRT052857	hsa-miR-3615	CLASH	23622248
MIRT711881	hsa-miR-3141	HITS-CLIP	19536157
MIRT711880	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT711879	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT711878	hsa-miR-663a	HITS-CLIP	19536157
MIRT711877	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT711876	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT711881	hsa-miR-3141	HITS-CLIP	19536157
MIRT711880	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT711879	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT711878	hsa-miR-663a	HITS-CLIP	19536157
MIRT711877	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT711876	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT711875	hsa-miR-4251	HITS-CLIP	19536157
MIRT711881	hsa-miR-3141	HITS-CLIP	19536157
MIRT711880	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT711879	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT711878	hsa-miR-663a	HITS-CLIP	19536157
MIRT711877	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT711876	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT711875	hsa-miR-4251	HITS-CLIP	19536157
MIRT651774	hsa-miR-4282	HITS-CLIP	23824327
MIRT651775	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT651773	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT651772	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT651770	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT651769	hsa-miR-623	HITS-CLIP	23824327
MIRT651768	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT651767	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT651766	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT651765	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT651764	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT651763	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT651774	hsa-miR-4282	HITS-CLIP	23824327
MIRT651775	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT651773	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT651772	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT651771	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT651770	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT651769	hsa-miR-623	HITS-CLIP	23824327
MIRT651768	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT651767	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT651766	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT651765	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT651764	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT651763	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT711881	hsa-miR-3141	HITS-CLIP	19536157
MIRT711880	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT711879	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT711878	hsa-miR-663a	HITS-CLIP	19536157
MIRT711877	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT711876	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT711881	hsa-miR-3141	HITS-CLIP	19536157
MIRT711880	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT711879	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT711878	hsa-miR-663a	HITS-CLIP	19536157
MIRT711877	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT711876	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT711875	hsa-miR-4251	HITS-CLIP	19536157
MIRT711881	hsa-miR-3141	HITS-CLIP	19536157
MIRT711880	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT711879	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT711878	hsa-miR-663a	HITS-CLIP	19536157
MIRT711877	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT711876	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT711875	hsa-miR-4251	HITS-CLIP	19536157
MIRT651774	hsa-miR-4282	HITS-CLIP	23824327
MIRT651775	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT651773	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT651772	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT651770	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT651769	hsa-miR-623	HITS-CLIP	23824327
MIRT651768	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT651767	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT651766	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT651765	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT651764	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT651763	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT651774	hsa-miR-4282	HITS-CLIP	23824327
MIRT651775	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT651773	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT651772	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT651771	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT651770	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT651769	hsa-miR-623	HITS-CLIP	23824327
MIRT651768	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT651767	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT651766	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT651765	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT651764	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT651763	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT1482878	hsa-miR-106a	CLIP-seq
MIRT1482879	hsa-miR-106b	CLIP-seq
MIRT1482880	hsa-miR-1207-5p	CLIP-seq
MIRT1482881	hsa-miR-1238	CLIP-seq
MIRT1482882	hsa-miR-1297	CLIP-seq
MIRT1482883	hsa-miR-1323	CLIP-seq
MIRT1482884	hsa-miR-17	CLIP-seq
MIRT1482885	hsa-miR-1827	CLIP-seq
MIRT1482886	hsa-miR-20a	CLIP-seq
MIRT1482887	hsa-miR-20b	CLIP-seq
MIRT1482888	hsa-miR-26a	CLIP-seq
MIRT1482889	hsa-miR-26b	CLIP-seq
MIRT1482890	hsa-miR-3120-3p	CLIP-seq
MIRT1482891	hsa-miR-3153	CLIP-seq
MIRT1482892	hsa-miR-3609	CLIP-seq
MIRT1482893	hsa-miR-3691-3p	CLIP-seq
MIRT1482894	hsa-miR-3910	CLIP-seq
MIRT1482895	hsa-miR-4465	CLIP-seq
MIRT1482896	hsa-miR-4493	CLIP-seq
MIRT1482897	hsa-miR-4763-3p	CLIP-seq
MIRT1482898	hsa-miR-4773	CLIP-seq
MIRT1482899	hsa-miR-4796-3p	CLIP-seq
MIRT1482900	hsa-miR-519d	CLIP-seq
MIRT1482901	hsa-miR-548ah	CLIP-seq
MIRT1482902	hsa-miR-548o	CLIP-seq
MIRT1482903	hsa-miR-93	CLIP-seq
MIRT1482904	hsa-miR-940	CLIP-seq
MIRT1555380	hsa-miR-214	CLIP-seq
MIRT1555381	hsa-miR-4455	CLIP-seq
MIRT2145366	hsa-miR-147b	CLIP-seq
MIRT2145367	hsa-miR-193a-5p	CLIP-seq
MIRT2145368	hsa-miR-2467-3p	CLIP-seq
MIRT2145369	hsa-miR-3126-5p	CLIP-seq
MIRT2145370	hsa-miR-3182	CLIP-seq
MIRT2145371	hsa-miR-3198	CLIP-seq
MIRT2145372	hsa-miR-324-5p	CLIP-seq
MIRT2145373	hsa-miR-339-5p	CLIP-seq
MIRT2145374	hsa-miR-3621	CLIP-seq
MIRT1482893	hsa-miR-3691-3p	CLIP-seq
MIRT2145375	hsa-miR-4271	CLIP-seq
MIRT2145376	hsa-miR-4309	CLIP-seq
MIRT2145377	hsa-miR-4314	CLIP-seq
MIRT2145378	hsa-miR-432	CLIP-seq
MIRT2145379	hsa-miR-4428	CLIP-seq
MIRT2145380	hsa-miR-4434	CLIP-seq
MIRT1555381	hsa-miR-4455	CLIP-seq
MIRT2145381	hsa-miR-4516	CLIP-seq
MIRT2145382	hsa-miR-4530	CLIP-seq
MIRT2145383	hsa-miR-4533	CLIP-seq
MIRT2145384	hsa-miR-4640-3p	CLIP-seq
MIRT2145385	hsa-miR-4653-3p	CLIP-seq
MIRT2145386	hsa-miR-4725-3p	CLIP-seq
MIRT2145387	hsa-miR-4747-5p	CLIP-seq
MIRT2365588	hsa-miR-1	CLIP-seq
MIRT1482880	hsa-miR-1207-5p	CLIP-seq
MIRT2365589	hsa-miR-1292	CLIP-seq
MIRT1482882	hsa-miR-1297	CLIP-seq
MIRT1482883	hsa-miR-1323	CLIP-seq
MIRT1482885	hsa-miR-1827	CLIP-seq
MIRT2365590	hsa-miR-206	CLIP-seq
MIRT1482888	hsa-miR-26a	CLIP-seq
MIRT1482889	hsa-miR-26b	CLIP-seq
MIRT2365591	hsa-miR-3150a-3p	CLIP-seq
MIRT1482891	hsa-miR-3153	CLIP-seq
MIRT2365592	hsa-miR-3175	CLIP-seq
MIRT2365593	hsa-miR-3667-3p	CLIP-seq
MIRT1482893	hsa-miR-3691-3p	CLIP-seq
MIRT2365594	hsa-miR-4279	CLIP-seq
MIRT2365595	hsa-miR-4287	CLIP-seq
MIRT1482895	hsa-miR-4465	CLIP-seq
MIRT2365596	hsa-miR-4469	CLIP-seq
MIRT2365597	hsa-miR-4471	CLIP-seq
MIRT2365598	hsa-miR-4481	CLIP-seq
MIRT2365599	hsa-miR-4654	CLIP-seq
MIRT2365600	hsa-miR-4685-3p	CLIP-seq
MIRT2365601	hsa-miR-4713-5p	CLIP-seq
MIRT2365602	hsa-miR-4745-5p	CLIP-seq
MIRT1482897	hsa-miR-4763-3p	CLIP-seq
MIRT2365603	hsa-miR-4769-5p	CLIP-seq
MIRT1482902	hsa-miR-548o	CLIP-seq
MIRT2365604	hsa-miR-613	CLIP-seq
MIRT2365605	hsa-miR-939	CLIP-seq
MIRT1482904	hsa-miR-940	CLIP-seq
MIRT2396786	hsa-miR-3127-3p	CLIP-seq
MIRT2365592	hsa-miR-3175	CLIP-seq
MIRT2365593	hsa-miR-3667-3p	CLIP-seq
MIRT2365592	hsa-miR-3175	CLIP-seq
MIRT2694924	hsa-miR-3689a-3p	CLIP-seq
MIRT2694925	hsa-miR-3689c	CLIP-seq
MIRT2145380	hsa-miR-4434	CLIP-seq
MIRT2694926	hsa-miR-4509	CLIP-seq
MIRT2145381	hsa-miR-4516	CLIP-seq
MIRT2694927	hsa-miR-4728-5p	CLIP-seq
MIRT2694928	hsa-miR-493	CLIP-seq
MIRT2694929	hsa-miR-548m	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001843	Process	Neural tube closure	IBA
GO:0001843	Process	Neural tube closure	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	8836115, 16189514, 16631741, 16940418, 17599063, 20195357, 21423205, 21911467, 23153535, 24076653, 25416956, 28514442, 29892012, 30021884, 32296183, 32814053, 33961781, 35044719, 35271311
GO:0005522	Function	Profilin binding	IBA
GO:0005522	Function	Profilin binding	IPI	17914456
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA
GO:0005925	Component	Focal adhesion	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0008154	Process	Actin polymerization or depolymerization	IBA
GO:0008154	Process	Actin polymerization or depolymerization	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	7828592
GO:0016020	Component	Membrane	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IBA
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	23153535
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031527	Component	Filopodium membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0051289	Process	Protein homotetramerization	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070161	Component	Anchoring junction	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
601703	12652	ENSG00000125753

P50552

Protein name

Vasodilator-stimulated phosphoprotein (VASP)

Protein function

Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance, lamellipodial and filopodial dynamics, platelet activation and cell migration. VASP pr

PDB

1EGX , 1USD , 1USE , 2PAV , 2PBD , 3CHW , 8GAT , 8GAU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00568	WH1	1 → 110	WH1 domain	Domain
PF08776	VASP_tetra	341 → 377	VASP tetramerisation domain	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in platelets. {ECO:0000269|PubMed:7828592}.

Sequence

MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
KVKEEIIEAFVQELRKRGSP

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway cGMP-PKG signaling pathway Focal adhesion Tight junction Platelet activation Fc gamma R-mediated phagocytosis Leukocyte transendothelial migration		Signaling by ROBO receptors Cell-extracellular matrix interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (61)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17938809, 29268886, 31351022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	19059569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29910076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	20467748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29914380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	23116430	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24361322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	30463566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19171136, 22320863, 25961924, 26336132, 28209486, 30008913, 30806044, 31257464, 31754343, 31831834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26336132, 28209486, 32141559, 37890607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30463566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	26336132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30816548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	15572040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	15572040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15634270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28388507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	28760439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28760439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30092744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	23751441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29460479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21702043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31270029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30156215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	16323337, 28682424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28682424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28300867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27447737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28300867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	23436459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35953476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19543319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31093978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18825362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	32938406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21931069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24894047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	32037394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26336132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25457586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	35793763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30968998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30279729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19171136, 22320863, 23129656, 25961924, 26336132, 28209486, 30008913, 30806044, 31257464, 31754343, 31831834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30816548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22189055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18357390, 30008913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18813837, 19115233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23129656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	20467748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20802179, 24917558, 28209486, 30816548, 31754343, 31831834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37947594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21874265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19081821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31270029		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28877606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22189055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	18637808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23685951, 31886120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31833035		★★★★★ ★☆☆☆☆ Found in Text Mining only

VASP (vasodilator stimulated phosphoprotein)