Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7405
Gene name	UV radiation resistance associated
Gene symbol	UVRAG
Synonyms (NCBI Gene)	DHTXVPS38p63
Chromosome	11
Chromosome location	11q13.5
Summary	This gene complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes a protein with a C2 domain. The protein activates the Beclin1-PI(3)KC3 complex, promoting autophagy and suppressing the proliferation and tumorigenicity o

332

Show/Hide all (332)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006270	hsa-miR-130b-3p	Luciferase reporter assay	22228303
MIRT006270	hsa-miR-130b-3p	Luciferase reporter assay	22228303
MIRT006270	hsa-miR-130b-3p	Luciferase reporter assay	22228303
MIRT006270	hsa-miR-130b-3p	Luciferase reporter assay	22228303
MIRT006270	hsa-miR-130b-3p	Luciferase reporter assay	22228303
MIRT006270	hsa-miR-130b-3p	Luciferase reporter assay	22228303
MIRT024353	hsa-miR-215-5p	Microarray	19074876
MIRT026688	hsa-miR-192-5p	Microarray	19074876
MIRT028338	hsa-miR-32-5p	Sequencing	20371350
MIRT040149	hsa-miR-615-3p	CLASH	23622248
MIRT000947	hsa-miR-203a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	22421148
MIRT438309	hsa-miR-33a-5p	ImmunoprecipitaionmicroarrayqRT-PCR	25202981
MIRT438309	hsa-miR-33a-5p	ImmunoprecipitaionmicroarrayqRT-PCR	25202981
MIRT001199	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT131664	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT028338	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT731446	hsa-miR-301a-3p	Luciferase reporter assay	26990571
MIRT731446	hsa-miR-301a-3p	Luciferase reporter assay	26990571
MIRT1481427	hsa-miR-106a	CLIP-seq
MIRT1481428	hsa-miR-106b	CLIP-seq
MIRT1481429	hsa-miR-1200	CLIP-seq
MIRT1481430	hsa-miR-1202	CLIP-seq
MIRT1481431	hsa-miR-1225-3p	CLIP-seq
MIRT1481432	hsa-miR-1225-5p	CLIP-seq
MIRT1481433	hsa-miR-1231	CLIP-seq
MIRT1481434	hsa-miR-1233	CLIP-seq
MIRT1481435	hsa-miR-125a-5p	CLIP-seq
MIRT1481436	hsa-miR-125b	CLIP-seq
MIRT1481437	hsa-miR-1276	CLIP-seq
MIRT1481438	hsa-miR-1284	CLIP-seq
MIRT1481439	hsa-miR-1290	CLIP-seq
MIRT1481440	hsa-miR-129-5p	CLIP-seq
MIRT1481441	hsa-miR-1299	CLIP-seq
MIRT1481442	hsa-miR-1305	CLIP-seq
MIRT1481443	hsa-miR-140-3p	CLIP-seq
MIRT1481444	hsa-miR-140-5p	CLIP-seq
MIRT1481445	hsa-miR-17	CLIP-seq
MIRT1481446	hsa-miR-181a	CLIP-seq
MIRT1481447	hsa-miR-181b	CLIP-seq
MIRT1481448	hsa-miR-181c	CLIP-seq
MIRT1481449	hsa-miR-181d	CLIP-seq
MIRT1481450	hsa-miR-1827	CLIP-seq
MIRT1481451	hsa-miR-20a	CLIP-seq
MIRT1481452	hsa-miR-20b	CLIP-seq
MIRT1481453	hsa-miR-2117	CLIP-seq
MIRT1481454	hsa-miR-216b	CLIP-seq
MIRT1481455	hsa-miR-2278	CLIP-seq
MIRT1481456	hsa-miR-25	CLIP-seq
MIRT1481457	hsa-miR-3132	CLIP-seq
MIRT1481458	hsa-miR-3135	CLIP-seq
MIRT1481459	hsa-miR-3148	CLIP-seq
MIRT1481460	hsa-miR-3171	CLIP-seq
MIRT1481461	hsa-miR-3189-3p	CLIP-seq
MIRT1481462	hsa-miR-32	CLIP-seq
MIRT1481463	hsa-miR-323-3p	CLIP-seq
MIRT1481464	hsa-miR-326	CLIP-seq
MIRT1481465	hsa-miR-330-5p	CLIP-seq
MIRT1481466	hsa-miR-335	CLIP-seq
MIRT1481467	hsa-miR-33a	CLIP-seq
MIRT1481468	hsa-miR-33b	CLIP-seq
MIRT1481469	hsa-miR-3609	CLIP-seq
MIRT1481470	hsa-miR-363	CLIP-seq
MIRT1481471	hsa-miR-3650	CLIP-seq
MIRT1481472	hsa-miR-367	CLIP-seq
MIRT1481473	hsa-miR-3688-3p	CLIP-seq
MIRT1481474	hsa-miR-3972	CLIP-seq
MIRT1481475	hsa-miR-4262	CLIP-seq
MIRT1481476	hsa-miR-4263	CLIP-seq
MIRT1481477	hsa-miR-4270	CLIP-seq
MIRT1481478	hsa-miR-4288	CLIP-seq
MIRT1481479	hsa-miR-4294	CLIP-seq
MIRT1481480	hsa-miR-4299	CLIP-seq
MIRT1481481	hsa-miR-4311	CLIP-seq
MIRT1481482	hsa-miR-4317	CLIP-seq
MIRT1481483	hsa-miR-4319	CLIP-seq
MIRT1481484	hsa-miR-433	CLIP-seq
MIRT1481485	hsa-miR-4422	CLIP-seq
MIRT1481486	hsa-miR-4441	CLIP-seq
MIRT1481487	hsa-miR-4447	CLIP-seq
MIRT1481488	hsa-miR-4455	CLIP-seq
MIRT1481489	hsa-miR-4456	CLIP-seq
MIRT1481490	hsa-miR-4472	CLIP-seq
MIRT1481491	hsa-miR-4509	CLIP-seq
MIRT1481492	hsa-miR-450b-5p	CLIP-seq
MIRT1481493	hsa-miR-4649-3p	CLIP-seq
MIRT1481494	hsa-miR-4684-5p	CLIP-seq
MIRT1481495	hsa-miR-4710	CLIP-seq
MIRT1481496	hsa-miR-4712-3p	CLIP-seq
MIRT1481497	hsa-miR-4728-3p	CLIP-seq
MIRT1481498	hsa-miR-4744	CLIP-seq
MIRT1481499	hsa-miR-4778-3p	CLIP-seq
MIRT1481500	hsa-miR-4789-3p	CLIP-seq
MIRT1481501	hsa-miR-4792	CLIP-seq
MIRT1481502	hsa-miR-4793-5p	CLIP-seq
MIRT1481503	hsa-miR-4796-3p	CLIP-seq
MIRT1481504	hsa-miR-4799-5p	CLIP-seq
MIRT1481505	hsa-miR-4802-3p	CLIP-seq
MIRT1481506	hsa-miR-519d	CLIP-seq
MIRT1481507	hsa-miR-539	CLIP-seq
MIRT1481508	hsa-miR-544b	CLIP-seq
MIRT1481509	hsa-miR-548ah	CLIP-seq
MIRT1481510	hsa-miR-548q	CLIP-seq
MIRT1481511	hsa-miR-570	CLIP-seq
MIRT1481512	hsa-miR-576-5p	CLIP-seq
MIRT1481513	hsa-miR-583	CLIP-seq
MIRT1481514	hsa-miR-629	CLIP-seq
MIRT1481515	hsa-miR-632	CLIP-seq
MIRT1481516	hsa-miR-664	CLIP-seq
MIRT1481517	hsa-miR-758	CLIP-seq
MIRT1481518	hsa-miR-875-3p	CLIP-seq
MIRT1481519	hsa-miR-92a	CLIP-seq
MIRT1481520	hsa-miR-92b	CLIP-seq
MIRT1481521	hsa-miR-93	CLIP-seq
MIRT1481477	hsa-miR-4270	CLIP-seq
MIRT1481479	hsa-miR-4294	CLIP-seq
MIRT1481486	hsa-miR-4441	CLIP-seq
MIRT1481477	hsa-miR-4270	CLIP-seq
MIRT1481479	hsa-miR-4294	CLIP-seq
MIRT1481486	hsa-miR-4441	CLIP-seq
MIRT2144852	hsa-miR-1253	CLIP-seq
MIRT2144853	hsa-miR-127-5p	CLIP-seq
MIRT2144854	hsa-miR-23a	CLIP-seq
MIRT2144855	hsa-miR-23b	CLIP-seq
MIRT2144856	hsa-miR-23c	CLIP-seq
MIRT2144857	hsa-miR-3136-3p	CLIP-seq
MIRT1481459	hsa-miR-3148	CLIP-seq
MIRT2144858	hsa-miR-3158-5p	CLIP-seq
MIRT2144859	hsa-miR-3184	CLIP-seq
MIRT2144860	hsa-miR-423-5p	CLIP-seq
MIRT1481477	hsa-miR-4270	CLIP-seq
MIRT1481479	hsa-miR-4294	CLIP-seq
MIRT2144861	hsa-miR-4303	CLIP-seq
MIRT2144862	hsa-miR-4328	CLIP-seq
MIRT2144863	hsa-miR-4418	CLIP-seq
MIRT2144864	hsa-miR-4426	CLIP-seq
MIRT2144865	hsa-miR-4434	CLIP-seq
MIRT1481486	hsa-miR-4441	CLIP-seq
MIRT2144866	hsa-miR-4495	CLIP-seq
MIRT2144867	hsa-miR-4516	CLIP-seq
MIRT2144868	hsa-miR-4647	CLIP-seq
MIRT1481493	hsa-miR-4649-3p	CLIP-seq
MIRT2144869	hsa-miR-4662b	CLIP-seq
MIRT2144870	hsa-miR-4668-5p	CLIP-seq
MIRT2144871	hsa-miR-4677-3p	CLIP-seq
MIRT2144872	hsa-miR-4717-3p	CLIP-seq
MIRT2144873	hsa-miR-4726-3p	CLIP-seq
MIRT1481497	hsa-miR-4728-3p	CLIP-seq
MIRT2144874	hsa-miR-4729	CLIP-seq
MIRT2144875	hsa-miR-4765	CLIP-seq
MIRT2144876	hsa-miR-4778-5p	CLIP-seq
MIRT2144877	hsa-miR-491-3p	CLIP-seq
MIRT2144878	hsa-miR-509-3-5p	CLIP-seq
MIRT2144879	hsa-miR-509-5p	CLIP-seq
MIRT2144880	hsa-miR-548m	CLIP-seq
MIRT2144881	hsa-miR-628-5p	CLIP-seq
MIRT2144882	hsa-miR-630	CLIP-seq
MIRT2144883	hsa-miR-654-3p	CLIP-seq
MIRT2365186	hsa-miR-1273f	CLIP-seq
MIRT2365187	hsa-miR-1301	CLIP-seq
MIRT2365188	hsa-miR-143	CLIP-seq
MIRT2365189	hsa-miR-2682	CLIP-seq
MIRT2365190	hsa-miR-2861	CLIP-seq
MIRT2365191	hsa-miR-3652	CLIP-seq
MIRT1481477	hsa-miR-4270	CLIP-seq
MIRT1481479	hsa-miR-4294	CLIP-seq
MIRT2365192	hsa-miR-4324	CLIP-seq
MIRT2365193	hsa-miR-4423-3p	CLIP-seq
MIRT2365194	hsa-miR-4430	CLIP-seq
MIRT1481486	hsa-miR-4441	CLIP-seq
MIRT2365195	hsa-miR-449c	CLIP-seq
MIRT2365196	hsa-miR-4505	CLIP-seq
MIRT2365197	hsa-miR-4520a-3p	CLIP-seq
MIRT2365198	hsa-miR-4520b-3p	CLIP-seq
MIRT1481493	hsa-miR-4649-3p	CLIP-seq
MIRT2365199	hsa-miR-4660	CLIP-seq
MIRT2365200	hsa-miR-4708-5p	CLIP-seq
MIRT2365201	hsa-miR-4727-5p	CLIP-seq
MIRT2365202	hsa-miR-4770	CLIP-seq
MIRT2365203	hsa-miR-4803	CLIP-seq
MIRT2365204	hsa-miR-5047	CLIP-seq
MIRT2365205	hsa-miR-579	CLIP-seq
MIRT1481516	hsa-miR-664	CLIP-seq
MIRT2365206	hsa-miR-940	CLIP-seq
MIRT1481477	hsa-miR-4270	CLIP-seq
MIRT1481479	hsa-miR-4294	CLIP-seq
MIRT1481486	hsa-miR-4441	CLIP-seq
MIRT2463128	hsa-miR-1910	CLIP-seq
MIRT2463129	hsa-miR-1913	CLIP-seq
MIRT2463130	hsa-miR-3189-5p	CLIP-seq
MIRT2463131	hsa-miR-324-3p	CLIP-seq
MIRT2463132	hsa-miR-452	CLIP-seq
MIRT2463133	hsa-miR-4676-3p	CLIP-seq
MIRT2365201	hsa-miR-4727-5p	CLIP-seq
MIRT2463134	hsa-miR-4758-3p	CLIP-seq
MIRT1481429	hsa-miR-1200	CLIP-seq
MIRT1481430	hsa-miR-1202	CLIP-seq
MIRT1481433	hsa-miR-1231	CLIP-seq
MIRT2658953	hsa-miR-1255a	CLIP-seq
MIRT2658954	hsa-miR-1255b	CLIP-seq
MIRT2365186	hsa-miR-1273f	CLIP-seq
MIRT1481439	hsa-miR-1290	CLIP-seq
MIRT1481440	hsa-miR-129-5p	CLIP-seq
MIRT2658955	hsa-miR-1298	CLIP-seq
MIRT1481442	hsa-miR-1305	CLIP-seq
MIRT1481443	hsa-miR-140-3p	CLIP-seq
MIRT2365188	hsa-miR-143	CLIP-seq
MIRT2658956	hsa-miR-1470	CLIP-seq
MIRT2463129	hsa-miR-1913	CLIP-seq
MIRT2658957	hsa-miR-1972	CLIP-seq
MIRT2658958	hsa-miR-205	CLIP-seq
MIRT2658959	hsa-miR-2114	CLIP-seq
MIRT1481456	hsa-miR-25	CLIP-seq
MIRT1481458	hsa-miR-3135	CLIP-seq
MIRT2658960	hsa-miR-3143	CLIP-seq
MIRT1481462	hsa-miR-32	CLIP-seq
MIRT2463131	hsa-miR-324-3p	CLIP-seq
MIRT2658961	hsa-miR-328	CLIP-seq
MIRT1481467	hsa-miR-33a	CLIP-seq
MIRT1481468	hsa-miR-33b	CLIP-seq
MIRT1481470	hsa-miR-363	CLIP-seq
MIRT2658962	hsa-miR-3654	CLIP-seq
MIRT1481472	hsa-miR-367	CLIP-seq
MIRT2658963	hsa-miR-378	CLIP-seq
MIRT2658964	hsa-miR-378b	CLIP-seq
MIRT2658965	hsa-miR-378c	CLIP-seq
MIRT2658966	hsa-miR-378d	CLIP-seq
MIRT2658967	hsa-miR-378e	CLIP-seq
MIRT2658968	hsa-miR-378f	CLIP-seq
MIRT2658969	hsa-miR-378h	CLIP-seq
MIRT2658970	hsa-miR-378i	CLIP-seq
MIRT1481474	hsa-miR-3972	CLIP-seq
MIRT2658971	hsa-miR-422a	CLIP-seq
MIRT1481478	hsa-miR-4288	CLIP-seq
MIRT1481480	hsa-miR-4299	CLIP-seq
MIRT2658972	hsa-miR-4312	CLIP-seq
MIRT1481482	hsa-miR-4317	CLIP-seq
MIRT2365192	hsa-miR-4324	CLIP-seq
MIRT1481484	hsa-miR-433	CLIP-seq
MIRT1481485	hsa-miR-4422	CLIP-seq
MIRT1481489	hsa-miR-4456	CLIP-seq
MIRT2658973	hsa-miR-4635	CLIP-seq
MIRT2658974	hsa-miR-4650-5p	CLIP-seq
MIRT2658975	hsa-miR-4667-3p	CLIP-seq
MIRT2658976	hsa-miR-4668-3p	CLIP-seq
MIRT2365200	hsa-miR-4708-5p	CLIP-seq
MIRT1481495	hsa-miR-4710	CLIP-seq
MIRT2658977	hsa-miR-4747-3p	CLIP-seq
MIRT2658978	hsa-miR-4762-5p	CLIP-seq
MIRT2365202	hsa-miR-4770	CLIP-seq
MIRT1481500	hsa-miR-4789-3p	CLIP-seq
MIRT1481501	hsa-miR-4792	CLIP-seq
MIRT2365203	hsa-miR-4803	CLIP-seq
MIRT2658979	hsa-miR-494	CLIP-seq
MIRT2658980	hsa-miR-499-3p	CLIP-seq
MIRT2658981	hsa-miR-499a-3p	CLIP-seq
MIRT1481508	hsa-miR-544b	CLIP-seq
MIRT2658982	hsa-miR-548ac	CLIP-seq
MIRT2658983	hsa-miR-548ae	CLIP-seq
MIRT2658984	hsa-miR-548aj	CLIP-seq
MIRT2658985	hsa-miR-548am	CLIP-seq
MIRT2658986	hsa-miR-548d-3p	CLIP-seq
MIRT1481510	hsa-miR-548q	CLIP-seq
MIRT2658987	hsa-miR-548x	CLIP-seq
MIRT2658988	hsa-miR-548z	CLIP-seq
MIRT2658989	hsa-miR-549	CLIP-seq
MIRT2144882	hsa-miR-630	CLIP-seq
MIRT1481515	hsa-miR-632	CLIP-seq
MIRT2144883	hsa-miR-654-3p	CLIP-seq
MIRT1481516	hsa-miR-664	CLIP-seq
MIRT2658990	hsa-miR-889	CLIP-seq
MIRT1481519	hsa-miR-92a	CLIP-seq
MIRT1481520	hsa-miR-92b	CLIP-seq
MIRT1481429	hsa-miR-1200	CLIP-seq
MIRT1481430	hsa-miR-1202	CLIP-seq
MIRT1481433	hsa-miR-1231	CLIP-seq
MIRT1481439	hsa-miR-1290	CLIP-seq
MIRT1481440	hsa-miR-129-5p	CLIP-seq
MIRT2658955	hsa-miR-1298	CLIP-seq
MIRT2694881	hsa-miR-136	CLIP-seq
MIRT1481443	hsa-miR-140-3p	CLIP-seq
MIRT2658956	hsa-miR-1470	CLIP-seq
MIRT2463129	hsa-miR-1913	CLIP-seq
MIRT2658958	hsa-miR-205	CLIP-seq
MIRT2658959	hsa-miR-2114	CLIP-seq
MIRT1481456	hsa-miR-25	CLIP-seq
MIRT1481458	hsa-miR-3135	CLIP-seq
MIRT2658960	hsa-miR-3143	CLIP-seq
MIRT1481462	hsa-miR-32	CLIP-seq
MIRT2463131	hsa-miR-324-3p	CLIP-seq
MIRT1481467	hsa-miR-33a	CLIP-seq
MIRT1481468	hsa-miR-33b	CLIP-seq
MIRT1481470	hsa-miR-363	CLIP-seq
MIRT2658962	hsa-miR-3654	CLIP-seq
MIRT1481472	hsa-miR-367	CLIP-seq
MIRT2658963	hsa-miR-378	CLIP-seq
MIRT2658964	hsa-miR-378b	CLIP-seq
MIRT2658965	hsa-miR-378c	CLIP-seq
MIRT2658966	hsa-miR-378d	CLIP-seq
MIRT2658967	hsa-miR-378e	CLIP-seq
MIRT2658968	hsa-miR-378f	CLIP-seq
MIRT2658969	hsa-miR-378h	CLIP-seq
MIRT2658970	hsa-miR-378i	CLIP-seq
MIRT1481474	hsa-miR-3972	CLIP-seq
MIRT2658971	hsa-miR-422a	CLIP-seq
MIRT1481478	hsa-miR-4288	CLIP-seq
MIRT1481480	hsa-miR-4299	CLIP-seq
MIRT1481482	hsa-miR-4317	CLIP-seq
MIRT2365192	hsa-miR-4324	CLIP-seq
MIRT1481484	hsa-miR-433	CLIP-seq
MIRT1481485	hsa-miR-4422	CLIP-seq
MIRT1481489	hsa-miR-4456	CLIP-seq
MIRT2658975	hsa-miR-4667-3p	CLIP-seq
MIRT2658976	hsa-miR-4668-3p	CLIP-seq
MIRT2694882	hsa-miR-4691-5p	CLIP-seq
MIRT1481495	hsa-miR-4710	CLIP-seq
MIRT1481500	hsa-miR-4789-3p	CLIP-seq
MIRT1481501	hsa-miR-4792	CLIP-seq
MIRT2365203	hsa-miR-4803	CLIP-seq
MIRT2658979	hsa-miR-494	CLIP-seq
MIRT2658980	hsa-miR-499-3p	CLIP-seq
MIRT2658981	hsa-miR-499a-3p	CLIP-seq
MIRT1481508	hsa-miR-544b	CLIP-seq
MIRT1481510	hsa-miR-548q	CLIP-seq
MIRT2658989	hsa-miR-549	CLIP-seq
MIRT2144882	hsa-miR-630	CLIP-seq
MIRT1481515	hsa-miR-632	CLIP-seq
MIRT2144883	hsa-miR-654-3p	CLIP-seq
MIRT1481516	hsa-miR-664	CLIP-seq
MIRT2694883	hsa-miR-885-5p	CLIP-seq
MIRT2658990	hsa-miR-889	CLIP-seq
MIRT1481519	hsa-miR-92a	CLIP-seq
MIRT1481520	hsa-miR-92b	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0000149	Function	SNARE binding	IEA
GO:0000323	Component	Lytic vacuole	IBA
GO:0000421	Component	Autophagosome membrane	IDA	28306502
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0005515	Function	Protein binding	IPI	17891140, 19050071, 19270696, 20562859, 21062745, 21597469, 22081109, 22354037, 22493499, 23954414, 24034250, 24056303, 24554770, 24785657, 24849286, 25490155, 26496610, 28306502, 28479384, 32296183, 33961781, 34386498, 35044719, 35271311, 37219487
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	TAS	9169138
GO:0005764	Component	Lysosome	IDA	19270696
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	19270696
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IDA	19270696
GO:0005770	Component	Late endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	24056303
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005813	Component	Centrosome	IDA	22542840
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IMP	22542840
GO:0006281	Process	DNA repair	TAS	9169138
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	24056303
GO:0006914	Process	Autophagy	IMP	24056303
GO:0006974	Process	DNA damage response	IEA
GO:0007051	Process	Spindle organization	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007098	Process	Centrosome cycle	IEA
GO:0007098	Process	Centrosome cycle	IMP	22542840
GO:0010506	Process	Regulation of autophagy	IDA	16799551
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030496	Component	Midbody	IDA	20643123
GO:0030496	Component	Midbody	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	20643123
GO:0032801	Process	Receptor catabolic process	IMP	20643123
GO:0032991	Component	Protein-containing complex	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IPI	25490155
GO:0035493	Process	SNARE complex assembly	IBA
GO:0035493	Process	SNARE complex assembly	IEA
GO:0036092	Process	Phosphatidylinositol-3-phosphate biosynthetic process	IDA	8999962
GO:0043933	Process	Protein-containing complex organization	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0051684	Process	Maintenance of Golgi location	IMP	24056303
GO:0070418	Component	DNA-dependent protein kinase complex	IDA	22542840
GO:0071900	Process	Regulation of protein serine/threonine kinase activity	IDA	22542840
GO:0071985	Process	Multivesicular body sorting pathway	TAS	21118109
GO:0097352	Process	Autophagosome maturation	IDA	28306502
GO:0097680	Process	Double-strand break repair via classical nonhomologous end joining	IDA	22542840
GO:1901098	Process	Positive regulation of autophagosome maturation	TAS	21118109

MIM	HGNC	e!Ensembl
602493	12640	ENSG00000198382

Q9P2Y5

Protein name

UV radiation resistance-associated gene protein (p63)

Protein function

Versatile protein that is involved in regulation of different cellular pathways implicated in membrane trafficking. Involved in regulation of the COPI-dependent retrograde transport from Golgi and the endoplasmic reticulum by associating with th

PDB

7BL1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10186	Atg14	184 → 471	Vacuolar sorting 38 and autophagy-related subunit 14	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain, lung, kidney and liver. {ECO:0000269|PubMed:10798355}.

Sequence

MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQ
LLDTYFTLHLCSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGG
KENIYQLLIEWKVCLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILL
QVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECL
QLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKEC
TAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQAKDDGSI
AVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKL
QFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKR
QSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGET
ERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTL
LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSA
VAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK

Sequence length

699

Interactions

View interactions

	KEGG		Reactome
	Autophagy - animal		Macroautophagy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (206)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24481878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11727253, 14562279, 14612504, 15551738, 16575619, 16884378, 20332665, 22935826, 24166777, 24194854, 25189640, 25982011, 27889037, 28394798, 28417484 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	11727253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25189640, 26603857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	29894516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	16445626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	31653135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16575619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	26332336, 31711519		★★★★★ ★☆☆☆☆ Found in Text Mining only
ADULT SYNDROME	ADULT Syndrome	BEFREE	11929852, 16724007, 17041931, 18388131, 19781362, 20543567, 23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	15752257, 28390135, 31187467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	BEFREE	16546853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10594758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	12234063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	22542840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22053213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	18603493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23837456, 26315281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	24482479		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12838557, 16918993, 26332336, 31831043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11727253, 14562279, 21703447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy and Epispadias Complex	Bladder Exstrophy And Epispadias Complex	BEFREE	23913486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10910040, 12368193, 22253920, 22361733, 24213852, 28794159, 29956121, 30104251, 30387298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12007564, 12653579, 14689049, 15489655, 15849742, 17639392, 19173015, 20225093, 20552547, 23548208, 24316488, 27555661, 28349272, 29484502, 31524947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10897041, 10910040, 11358835, 11381365, 11592094, 11948487, 11956072, 12185332, 12358808, 14654529, 15183414, 15489655, 15752257, 16445626, 17385050 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12368193, 14654529, 22253920, 22361733, 24213852, 28794159, 29956121, 30104251, 30387298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	15768819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14612504, 15466179, 20332665, 22441934, 25982011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11532371, 12358808, 26068789, 31278765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	11381365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23095717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	24418859, 28821190		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16884378, 20442293, 30973901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10568821, 20442293, 21980285, 30973901, 31211485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	12928850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondroblastoma	Chondroblastoma	BEFREE	18192965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29441939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16979518, 30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21906144, 30447004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20724836, 22155142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16575619, 18495205, 20724836, 26234763, 26327192, 30393117, 31056618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16575619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24956373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	23548208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ankyloblepharon	Congenital Ankyloblepharon	BEFREE	12692135, 12766194, 12932250, 17164413, 21965674, 22329826, 23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Foot Deformity	Congenital deformity of foot	BEFREE	11787035, 17915261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29716728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	20128632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30925220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29442026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	26768665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15248062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	23355676, 31413199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26332336, 31711519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22751441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	12185332, 20225093, 25810244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11474290, 12653579, 20225093, 25810244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	11879774, 11903230, 12766194, 15550149, 15725251, 16187309, 16546853, 16679535, 16691622, 16724007, 17164413, 17224651, 18603493, 19676060, 21471985 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	BEFREE	10769197, 11012604, 11462173, 11595015, 11929852, 12164578, 12766194, 14656652, 14699611, 17041931, 22069181, 22342398, 30566872		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21652629, 23355676, 23355677, 24569166, 28513979, 30566872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26768665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	22441934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22441934, 28511869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	28595997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	17264681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12447998, 19725154, 24718831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12447998, 24718831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	28682143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	18769338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	19840326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	25256005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28480888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	11474290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	16979518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	18192965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	39348350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29396915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16393253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hay-Wells syndrome	Hay-Wells syndrome	BEFREE	11159940, 12692135, 12766194, 12932250, 16177572, 16190990, 16258268, 16365259, 16532463, 16679535, 18364388, 19676060, 20738799, 21615690, 21652629 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27034006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29716728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22497596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	30558966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	28595997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	BEFREE	30088137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	19840326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17498688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	20225093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	12185332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	23921950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	31187467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	BEFREE	28595997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	28153507, 30719810, 31706671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	12379767		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	28346726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	16691622, 16724007, 17041931, 17224651, 19676060		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	11462173, 17164413, 23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limbal stem cell deficiency	Limbal stem cell deficiency	BEFREE	21959367, 28758321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23725313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20233581, 28350813, 30686098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31488173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11354544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15551738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29710477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26332336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15887287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	17107393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Cystosarcoma Phyllodes	Cystosarcoma Phyllodes	BEFREE	28968268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27034006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17115439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ascending colon	Ascending colon cancer	BEFREE	12928850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12007564, 15849742, 17639392, 19173015, 21363924, 24316488, 24525232, 25893299, 26825981, 27555661, 28349272, 29484502, 31524947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28511869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12447998, 24718831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14612504, 15466179, 20332665, 22441934, 25982011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23725313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21917857, 23095717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28104298, 29772221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11956072, 12553000, 14607218, 18781151, 19142959, 22949650, 26990571, 29241741, 29761525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22249251, 31744230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26406948, 30221685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16322335, 17395974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12368193, 22253920, 22361733, 24213852, 28794159, 29956121, 30104251, 30387298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10618710, 12750249, 14654529, 14689049, 15095006, 15248062, 15280445, 15564824, 15990899, 16084953, 16359856, 16445626, 16462763, 16861923, 16918993 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20442293, 30973901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20724836, 22155142, 30700826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24316488, 25893299, 26840455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	31831043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	19536621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	19536621		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12429996, 21951600, 27203177, 28982601, 30061422, 30209981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	19400830, 21765392, 31809560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	21777943, 24513264, 29975250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	31169683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21269671, 27807867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18813784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	15564824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10568821, 10769197, 10897041, 11136565, 11358835, 11381365, 11532371, 11592094, 11957139, 12234063, 12358808, 12368193, 12429996, 12434410, 12447998 View all (106 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19173015, 31132652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10769197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	11381365, 15551738, 28417484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14612504, 21289519, 23064619, 23319821, 28730709, 30798982, 31206846, 31614634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12185332, 26330357, 26343330, 27060708, 28549030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17568187, 22623071, 25085524		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16445626, 17880529, 23095717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28104298, 29772221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22053213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	20128632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19493635, 25577570, 29201169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	15489655, 28968268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	23278235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	27341130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11956072, 12553000, 14607218, 18781151, 19142959, 22949650, 26990571, 29241741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16417229, 21373745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	19288018		★★★★★ ★☆☆☆☆ Found in Text Mining only
RAPP-HODGKIN SYNDROME	RAPP-HODGKIN SYNDROME	BEFREE	12766194, 15725251, 15807690, 16190990, 16532463, 18364388, 19676060, 22342398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23158209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28129571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	39528529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rudiger syndrome 1	Rudiger syndrome	BEFREE	10535733, 10839977, 11012604, 11159940, 11462173, 11903230, 11929852, 12161593, 17041931, 18603493, 20180707, 21652629, 21959367, 22056627, 23407076 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	16084953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15489655, 19898465, 29441939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16979518, 30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	23589895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31831743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs inversus totalis	Situs Inversus	BEFREE	12928850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	19681128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16512680, 20332665, 25906121, 31263838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	18192965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 15 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	30081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Split foot	Split Hand Foot Deformity	BEFREE	11787035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	10769197, 11012604, 11462173, 11595015, 11929852, 12164578, 12766194, 14656652, 14699611, 17041931, 22069181, 22342398, 30566872		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPLIT-HAND/FOOT MALFORMATION 3	Split-Hand-Foot Malformation	BEFREE	14699611		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPLIT-HAND/FOOT MALFORMATION 4	Split-Hand-Foot Malformation	BEFREE	16258268, 16861923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11531258, 11727253, 11957139, 12086851, 12358808, 12447998, 12934112, 14562279, 14612504, 15183414, 15201986, 15551738, 16687923, 17018588, 17637751 View all (40 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	14562279, 19725154, 27029934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31206846, 31551362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	14997391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24417641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12782800, 15201986, 15564824, 16273222, 16393253, 16885742, 17418619, 17935121, 18087216, 18418053, 19391123, 21088498, 21705376, 28041841, 29162693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21705376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	27223861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28480888, 28621331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26406948, 30221685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20205286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	BEFREE	17915261		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10769197		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	17880529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	17880529, 30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16322335, 17395974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12234063, 16322335, 17395974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28488128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	20180707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21252285, 22801492, 28349272, 29484502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	11381365, 25902392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	21965674, 28604778, 28803895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	14654529, 28088268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	11381365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18477895, 27584665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	20163458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar Lichen Sclerosus	BEFREE	27223861		★★★★★ ★☆☆☆☆ Found in Text Mining only

UVRAG (UV radiation resistance associated)