Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7404
Gene name	Ubiquitously transcribed tetratricopeptide repeat containing, Y-linked
Gene symbol	UTY
Synonyms (NCBI Gene)	KDM6ALKDM6CUTY1
Chromosome	Y
Chromosome location	Yq11.221
Summary	This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. The encoded protein is also a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. A

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments
MIRT1481404	hsa-miR-1200	CLIP-seq
MIRT1481405	hsa-miR-1238	CLIP-seq
MIRT1481406	hsa-miR-19a	CLIP-seq
MIRT1481407	hsa-miR-19b	CLIP-seq
MIRT1481408	hsa-miR-200b	CLIP-seq
MIRT1481409	hsa-miR-200c	CLIP-seq
MIRT1481410	hsa-miR-2278	CLIP-seq
MIRT1481411	hsa-miR-298	CLIP-seq
MIRT1481412	hsa-miR-3074-5p	CLIP-seq
MIRT1481413	hsa-miR-3124-3p	CLIP-seq
MIRT1481414	hsa-miR-3127-3p	CLIP-seq
MIRT1481415	hsa-miR-3140-5p	CLIP-seq
MIRT1481416	hsa-miR-3149	CLIP-seq
MIRT1481417	hsa-miR-374c	CLIP-seq
MIRT1481418	hsa-miR-412	CLIP-seq
MIRT1481419	hsa-miR-429	CLIP-seq
MIRT1481420	hsa-miR-4468	CLIP-seq
MIRT1481421	hsa-miR-4691-5p	CLIP-seq
MIRT1481422	hsa-miR-4709-3p	CLIP-seq
MIRT1481423	hsa-miR-513a-3p	CLIP-seq
MIRT1481424	hsa-miR-568	CLIP-seq
MIRT1481425	hsa-miR-655	CLIP-seq
MIRT1481426	hsa-miR-885-5p	CLIP-seq
MIRT1481404	hsa-miR-1200	CLIP-seq
MIRT2144846	hsa-miR-2117	CLIP-seq
MIRT2144847	hsa-miR-224	CLIP-seq
MIRT1481411	hsa-miR-298	CLIP-seq
MIRT1481412	hsa-miR-3074-5p	CLIP-seq
MIRT1481415	hsa-miR-3140-5p	CLIP-seq
MIRT2144848	hsa-miR-375	CLIP-seq
MIRT2144849	hsa-miR-4273	CLIP-seq
MIRT2144850	hsa-miR-4677-5p	CLIP-seq
MIRT2144851	hsa-miR-4684-5p	CLIP-seq
MIRT1481422	hsa-miR-4709-3p	CLIP-seq
MIRT1481423	hsa-miR-513a-3p	CLIP-seq
MIRT1481404	hsa-miR-1200	CLIP-seq
MIRT1481410	hsa-miR-2278	CLIP-seq
MIRT1481411	hsa-miR-298	CLIP-seq
MIRT1481412	hsa-miR-3074-5p	CLIP-seq
MIRT1481415	hsa-miR-3140-5p	CLIP-seq
MIRT1481422	hsa-miR-4709-3p	CLIP-seq
MIRT1481423	hsa-miR-513a-3p	CLIP-seq
MIRT1481408	hsa-miR-200b	CLIP-seq
MIRT1481409	hsa-miR-200c	CLIP-seq
MIRT2396776	hsa-miR-369-3p	CLIP-seq
MIRT2396777	hsa-miR-374a	CLIP-seq
MIRT2396778	hsa-miR-374b	CLIP-seq
MIRT1481419	hsa-miR-429	CLIP-seq
MIRT2396779	hsa-miR-548c-3p	CLIP-seq
MIRT1481424	hsa-miR-568	CLIP-seq
MIRT2463125	hsa-miR-4480	CLIP-seq
MIRT2463126	hsa-miR-4776-3p	CLIP-seq
MIRT2463127	hsa-miR-556-3p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0007507	Process	Heart development	IBA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0032452	Function	Histone demethylase activity	IEA
GO:0032452	Function	Histone demethylase activity	TAS
GO:0044666	Component	MLL3/4 complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0071558	Function	Histone H3K27me2/H3K27me3 demethylase activity	IBA
GO:0071558	Function	Histone H3K27me2/H3K27me3 demethylase activity	IEA

MIM	HGNC	e!Ensembl
400009	12638	ENSG00000183878

O14607

Protein name

Histone demethylase UTY (EC 1.14.11.68) (Ubiquitously-transcribed TPR protein on the Y chromosome) (Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein) ([histone H3]-trimethyl-L-lysine(27) demethylase UTY)

Protein function

Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.

PDB

3ZLI , 3ZPO , 4UF0 , 5A1L , 5FXV , 5FXW , 5FXX , 5FXZ , 5FY0 , 5FY1 , 5FY7 , 5FYM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13181	TPR_8	202 → 233	Tetratricopeptide repeat	Repeat
PF02373	JmjC	1080 → 1188	JmjC domain, hydroxylase	Domain

Sequence

MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLH
EDGARTKTLLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQ
ADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDY
KSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLPAQVKA
TVLQQLGWMHHNMDLVGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDA
FISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYE
SCNQPQDAIKCYLNAARSKRCSNTSTLAARIKFLQNGSDNWNGGQSLSHHPVQQVYSLCL
TPQKLQHLEQLRANRDNLNPAQKHQLEQLESQFVLMQQMRHKEVAQVRTTGIHNGAITDS
SLPTNSVSNRQPHGALTRVSSVSQPGVRPACVEKLLSSGAFSAGCIPCGTSKILGSTDTI
LLGSNCIAGSESNGNVPYLQQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCL
SGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATSGGQQG
IMFTKESKPSKNRSLVPETSRHTGDTSNGCADVKGLSNHVHQLIADAVSSPNHGDSPNLL
IADNPQLSALLIGKANGNVGTGTCDKVNNIHPAVHTKTDHSVASSPSSAISTATPSPKST
EQRSINSVTSLNSPHSGLHTVNGEGLGKSQSSTKVDLPLASHRSTSQILPSMSVSICPSS
TEVLKACRNPGKNGLSNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFF
PPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWD
PTGTKKIWRCESNRSHTTIAKYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGR
RRKGPFKTIKFGTNIDLSDNKKWKLQLHELTKLPAFARVVSAGNLLTHVGHTILGMNTVQ
LYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSW
WPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLTACQYKLAV
ERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAA
GKEVIWHGRTNDEPAHYCSICEVEVFNLLFVTNESNTQKTYIVHCHDCARKTSKSLENFV
VLEQYKMEDLIQVYDQFTLALSLSSSS

Sequence length

1347

Interactions

View interactions

	Reactome
			HDMs demethylate histones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27533081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27533081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33381555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28332632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	30262602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	19617372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kabuki make-up syndrome	Kabuki Syndrome	BEFREE	25972376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27533081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29533787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19430297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	27302555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27533081	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

UTY (ubiquitously transcribed tetratricopeptide repeat containing, Y-linked)