Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7401
Gene name	Clarin 1
Gene symbol	CLRN1
Synonyms (NCBI Gene)	RP61USH3USH3A
Chromosome	3
Chromosome location	3q25.1
Summary	This gene encodes a protein that contains a cytosolic N-terminus, multiple helical transmembrane domains, and an endoplasmic reticulum membrane retention signal, TKGH, in the C-terminus. The encoded protein may be important in development and homeostasis

Show/Hide all (18)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908140	A>C,G,T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant, 3 prime UTR variant, stop gained
rs121908141	A>G,T	Pathogenic	Non coding transcript variant, missense variant, synonymous variant, coding sequence variant
rs121908142	A>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant, 3 prime UTR variant
rs201205811	C>T	Pathogenic	Splice donor variant
rs201625237	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant, 3 prime UTR variant, non coding transcript variant
rs373208120	G>A	Pathogenic	Stop gained, 3 prime UTR variant, coding sequence variant, intron variant, non coding transcript variant
rs374963432	G>T	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained, non coding transcript variant, missense variant
rs376155416	G>A,T	Likely-pathogenic	3 prime UTR variant, missense variant, coding sequence variant, non coding transcript variant, stop gained
rs397517932	GACAT>-	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs746523071	->T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, 3 prime UTR variant
rs775098953	A>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant, 3 prime UTR variant
rs1057516687	->A	Likely-pathogenic	Splice donor variant
rs1085307049	ATA>-	Pathogenic	3 prime UTR variant, non coding transcript variant, coding sequence variant, inframe indel
rs1231668679	A>-	Pathogenic	Intron variant, coding sequence variant, non coding transcript variant, frameshift variant, 3 prime UTR variant
rs1553772595	A>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1559982739	A>G	Pathogenic	Non coding transcript variant, missense variant, synonymous variant, coding sequence variant
rs1576623563	T>A	Likely-pathogenic	Splice acceptor variant
rs1576631624	AAGAAGGCTG>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments
MIRT897755	hsa-miR-30a	CLIP-seq
MIRT897756	hsa-miR-30b	CLIP-seq
MIRT897757	hsa-miR-30c	CLIP-seq
MIRT897758	hsa-miR-30d	CLIP-seq
MIRT897759	hsa-miR-30e	CLIP-seq
MIRT897760	hsa-miR-329	CLIP-seq
MIRT897761	hsa-miR-362-3p	CLIP-seq
MIRT897762	hsa-miR-3941	CLIP-seq
MIRT897763	hsa-miR-466	CLIP-seq
MIRT897764	hsa-miR-4672	CLIP-seq
MIRT897765	hsa-miR-4789-3p	CLIP-seq
MIRT897766	hsa-miR-600	CLIP-seq
MIRT897767	hsa-miR-603	CLIP-seq
MIRT897760	hsa-miR-329	CLIP-seq
MIRT897761	hsa-miR-362-3p	CLIP-seq
MIRT897762	hsa-miR-3941	CLIP-seq
MIRT897763	hsa-miR-466	CLIP-seq
MIRT897764	hsa-miR-4672	CLIP-seq
MIRT897765	hsa-miR-4789-3p	CLIP-seq
MIRT897768	hsa-miR-4802-5p	CLIP-seq
MIRT897766	hsa-miR-600	CLIP-seq
MIRT897767	hsa-miR-603	CLIP-seq
MIRT897760	hsa-miR-329	CLIP-seq
MIRT1546519	hsa-miR-3617	CLIP-seq
MIRT897761	hsa-miR-362-3p	CLIP-seq
MIRT897762	hsa-miR-3941	CLIP-seq
MIRT1546520	hsa-miR-4476	CLIP-seq
MIRT897763	hsa-miR-466	CLIP-seq
MIRT897764	hsa-miR-4672	CLIP-seq
MIRT897766	hsa-miR-600	CLIP-seq
MIRT897767	hsa-miR-603	CLIP-seq
MIRT1546521	hsa-miR-641	CLIP-seq
MIRT1546522	hsa-miR-7	CLIP-seq
MIRT1966227	hsa-miR-1185	CLIP-seq
MIRT1966228	hsa-miR-1224-5p	CLIP-seq
MIRT1966229	hsa-miR-1252	CLIP-seq
MIRT1966230	hsa-miR-214	CLIP-seq
MIRT1966231	hsa-miR-3605-5p	CLIP-seq
MIRT1966232	hsa-miR-3619-5p	CLIP-seq
MIRT1966233	hsa-miR-3679-5p	CLIP-seq
MIRT1966234	hsa-miR-3915	CLIP-seq
MIRT1966235	hsa-miR-4689	CLIP-seq
MIRT1966236	hsa-miR-4760-5p	CLIP-seq
MIRT1966237	hsa-miR-657	CLIP-seq
MIRT1966238	hsa-miR-761	CLIP-seq
MIRT2202018	hsa-miR-2277-3p	CLIP-seq
MIRT897760	hsa-miR-329	CLIP-seq
MIRT1546519	hsa-miR-3617	CLIP-seq
MIRT897761	hsa-miR-362-3p	CLIP-seq
MIRT897762	hsa-miR-3941	CLIP-seq
MIRT897763	hsa-miR-466	CLIP-seq
MIRT897764	hsa-miR-4672	CLIP-seq
MIRT897765	hsa-miR-4789-3p	CLIP-seq
MIRT2202019	hsa-miR-542-3p	CLIP-seq
MIRT897766	hsa-miR-600	CLIP-seq
MIRT897767	hsa-miR-603	CLIP-seq
MIRT1546521	hsa-miR-641	CLIP-seq
MIRT1546522	hsa-miR-7	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	19423712
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IDA	19423712
GO:0007015	Process	Actin filament organization	IDA	19423712
GO:0007601	Process	Visual perception	IEA
GO:0007605	Process	Sensory perception of sound	IBA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IMP	15650299
GO:0010592	Process	Positive regulation of lamellipodium assembly	IDA	19423712
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016020	Component	Membrane	IEA
GO:0030027	Component	Lamellipodium	IDA	19423712
GO:0030140	Component	Trans-Golgi network transport vesicle	IEA
GO:0032420	Component	Stereocilium	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0045494	Process	Photoreceptor cell maintenance	IMP	15521980
GO:0048870	Process	Cell motility	IDA	19423712
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0050953	Process	Sensory perception of light stimulus	IMP	15521980
GO:0050957	Process	Equilibrioception	IBA
GO:0050957	Process	Equilibrioception	IMP	15521980
GO:0060088	Process	Auditory receptor cell stereocilium organization	IEA
GO:0060117	Process	Auditory receptor cell development	IEA
GO:0098858	Component	Actin-based cell projection	IEA

MIM	HGNC	e!Ensembl
606397	12605	ENSG00000163646

P58418

Protein name

Clarin-1 (Usher syndrome type-3 protein)

Protein function

May have a role in the excitatory ribbon synapse junctions between hair cells and cochlear ganglion cells and presumably also in analogous synapses within the retina.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Found in the retina.

Sequence

MPSQQKKIIFCMAGVFSFACALGVVTALGTPLWIKATVLCKTGALLVNASGQELDKFMGE
MQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFM
YNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKT
QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY

Sequence length

232

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CLRN1-related disorder	Likely pathogenic; Pathogenic	rs746523071, rs111033267	RCV003398866 RCV003407275	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing impairment	Likely pathogenic; Pathogenic	rs121908140, rs1553776135	RCV001375084 RCV001375069	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neuronal ceroid lipofuscinosis	Pathogenic; Likely pathogenic	rs2107927719, rs2472761635, rs2472830838, rs1715594024	RCV005635607 RCV005636943 RCV005632688 RCV005633877	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rare genetic deafness	Pathogenic; Likely pathogenic	rs786204428, rs111033267, rs111033434, rs397517932, rs374963432	RCV000844691 RCV000844690 RCV000041430 RCV000844625 RCV000844624	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Retinal dystrophy	Pathogenic; Likely pathogenic	rs762606406, rs746523071, rs786204428, rs878853379, rs2472830632, rs374390376, rs1235835151, rs1715594024, rs746128095	RCV004815586 RCV001073703 RCV001073424 RCV000225684 RCV003890841 View all (4 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Retinitis pigmentosa	Pathogenic; Likely pathogenic	rs762606406, rs121908140, rs111033267, rs1576623563	RCV002506728 RCV002496258 RCV000505037 RCV000787816	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis pigmentosa 61	Pathogenic; Likely pathogenic	rs762606406, rs752910161, rs1380661508, rs745585873, rs1329440649, rs746523071, rs786204428, rs1463067573, rs121908140, rs1085307049, rs121908142, rs111033267, rs2107927719, rs2472831349, rs2472831271 View all (21 more)	RCV002506728 RCV003469761 RCV003470922 RCV003471164 RCV005032114 View all (35 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Usher syndrome	Pathogenic; Likely pathogenic	rs762606406, rs1380661508, rs2107927808, rs746523071, rs397517932, rs374963432, rs746128095, rs1715589813	RCV004770188 RCV001806792 RCV005238105 RCV002281991 RCV002273943 RCV001582535 RCV004690033 RCV002274178 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Usher syndrome type 3	Likely pathogenic; Pathogenic	rs746523071, rs786204428, rs121908140, rs121908141, rs1085307049, rs121908142, rs111033267, rs1553776036, rs201205811, rs376155416, rs397517932, rs374963432, rs1559982739, rs933370216, rs1576651623 View all (3 more)	RCV000169229 RCV000169027 RCV000004642 RCV000004643 RCV000004644 View all (14 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Usher syndrome type 3A	Pathogenic; Likely pathogenic	rs762606406, rs2107927490, rs1380661508, rs1329440649, rs746523071, rs786204428, rs121908140, rs111033267, rs373208120, rs1057516687, rs1057517224, rs376155416, rs1553776061, rs1553776112, rs1553776052 View all (9 more)	RCV002506728 RCV001823290 RCV005038333 RCV005032114 RCV001273481 View all (20 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRANCHIO-OTO-RENAL SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melnick-Fraser syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic atrophy	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
RETINITIS PIGMENTOSA 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis Pigmentosa, Dominant	Conflicting classifications of pathogenicity; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis pigmentosa-deafness syndrome	Conflicting classifications of pathogenicity; Uncertain significance; Benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
USHER SYNDROME, TYPE III	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
USHER SYNDROME, TYPE IIIA	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Albinism	Albinism	Pubtator	39596324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	22787034, 26180195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	22938382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	39596324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	20236115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	39304915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ear Diseases	Ear Diseases	BEFREE	19414487, 22787034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	39304915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemianopsia	Hemianopsia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
obsolete Rod-cone dystrophy	Rod-cone dystrophy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	10745043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Retinal Dystrophies	Retinal Dystrophy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	CLINVAR_DG	12080385		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	12834121, 16545802, 21310491, 24664766, 25798947, 30578505		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis pigmentosa	Retinitis Pigmentosa	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	26338283, 29545425, 31960602, 31968401	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis Pigmentosa	Retinitis Pigmentosa	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RETINITIS PIGMENTOSA 61	Retinitis Pigmentosa	UNIPROT_DG	21310491		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
RETINITIS PIGMENTOSA 61	Retinitis Pigmentosa	GENOMICS_ENGLAND_DG	9719374		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
RETINITIS PIGMENTOSA 61	Retinitis Pigmentosa	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
RETINITIS PIGMENTOSA 61	Retinitis Pigmentosa	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Retinitis punctata albescens (disorder)	Retinitis punctata albescens	BEFREE	12834121		★★★★★ ★☆☆☆☆ Found in Text Mining only
RHYNS syndrome	Rhyns syndrome	Pubtator	39596563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	26881841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11701652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher Syndrome	Usher Syndrome	LHGDN	11524702, 12080385		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Usher Syndrome	Usher Syndrome	BEFREE	12834121, 15521980, 16028794, 16545802, 17093394, 17893653, 19414487, 19683999, 21675857, 22681893, 22787034, 22938382, 23304067, 26180195, 28031293 View all (7 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Usher syndrome type 1B	Usher syndrome	Pubtator	22681893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher syndrome type 3	Usher Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
USHER SYNDROME, TYPE IC	Usher Syndrome	BEFREE	29985171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher Syndrome, Type III	Usher Syndrome	BEFREE	10704288, 12834121, 15521980, 15650299, 18281613, 19680541, 19753315, 20717163, 21310491, 21675857, 22964989, 23304067, 25743179, 26180195, 26881841 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndrome, Type III	Usher Syndrome	CLINVAR_DG	11524702, 12080385, 12145752, 14569126, 16028794, 16963483, 17407589, 17893653, 18273898, 18281613, 19423712, 19753315, 21675857, 22135276, 22787034 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndrome, Type III	Usher Syndrome	UNIPROT_DG	11524702, 12080385, 12145752, 15521980, 18273898, 23304067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndrome, Type III	Usher Syndrome	CLINGEN_DG	11524702, 19539019, 19753315, 21675857, 22135276, 22363448, 22787034, 24045267, 24596593, 26943149, 27110679		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndrome, Type III	Usher Syndrome	ORPHANET_DG	19753315		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndrome, Type III	Usher Syndrome	GENOMICS_ENGLAND_DG	9719374		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndrome, Type III	Usher Syndrome	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Usher Syndromes	Usher syndrome	Pubtator	19753315, 20717163, 22681893, 22964989, 23304067, 25404053, 25804404, 26338283, 28469144, 35481838, 39304915, 39337481, 9719374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLRN1 (clarin 1)