Gene Gene information from NCBI Gene database.
Entrez ID 740
Gene name Mitochondrial ribosomal protein L49
Gene symbol MRPL49
Synonyms (NCBI Gene)
C11orf4COXPD60L49mtMRP-L49NOFNOF1mL49
Chromosome 11
Chromosome location 11q13.1
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
498
miRTarBase ID miRNA Experiments Reference
MIRT022214 hsa-miR-124-3p Microarray 18668037
MIRT038871 hsa-miR-93-3p CLASH 23622248
MIRT649011 hsa-miR-888-5p HITS-CLIP 23824327
MIRT649010 hsa-miR-6808-5p HITS-CLIP 23824327
MIRT649008 hsa-miR-6893-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
GO:0005515 Function Protein binding IPI 20601428, 32814053, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 28892042
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606866 1176 ENSG00000149792
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13405
Protein name Large ribosomal subunit protein mL49 (39S ribosomal protein L49, mitochondrial) (L49mt) (MRP-L49) (Neighbor of FAU) (NOF) (Protein NOF1)
PDB 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05046 Img2 82 166 Mitochondrial large subunit ribosomal protein (Img2) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDP
PKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWAL
QKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
Sequence length 166
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PERRAULT SYNDROME 1 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 26072495 Associate
★☆☆☆☆
Found in Text Mining only
Combined Oxidative Phosphorylation Deficiency 1 Combined oxidative phosphorylation deficiency Pubtator 40043708 Associate
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis BEFREE 18985702, 21352802
★☆☆☆☆
Found in Text Mining only
Gonadal dysgenesis XX type deafness Gonadal dysgenesis Pubtator 40043708 Associate
★☆☆☆☆
Found in Text Mining only
Hearing Loss Sensorineural Hearing loss Pubtator 40043708 Associate
★☆☆☆☆
Found in Text Mining only
Learning Disabilities Learning disorders Pubtator 40043708 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 29781401 Associate
★☆☆☆☆
Found in Text Mining only
Leukodystrophy Metachromatic Metachromatic leukodystrophy Pubtator 40043708 Associate
★☆☆☆☆
Found in Text Mining only
melanoma Melanoma CTD_human_DG 22535842
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Microcephaly Microcephaly Pubtator 40043708 Associate
★☆☆☆☆
Found in Text Mining only