Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7392
Gene name	Upstream transcription factor 2, c-fos interacting
Gene symbol	USF2
Synonyms (NCBI Gene)	FIPbHLHb12
Chromosome	19
Chromosome location	19q13.12
Summary	This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multipl

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003896	hsa-miR-10a-5p	Luciferase reporter assayqRT-PCRWestern blot	19074828
MIRT007350	hsa-miR-362-3p	Western blot	23280316
MIRT007350	hsa-miR-362-3p	Western blot	23280316
MIRT007350	hsa-miR-362-3p	Western blot	23280316
MIRT007350	hsa-miR-362-3p	Western blot	23280316
MIRT018532	hsa-miR-335-5p	Microarray	18185580
MIRT044796	hsa-miR-320a	CLASH	23622248
MIRT042794	hsa-miR-339-5p	CLASH	23622248
MIRT621606	hsa-miR-1295b-5p	HITS-CLIP	23824327
MIRT621605	hsa-miR-1912	HITS-CLIP	23824327
MIRT621604	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT621603	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT621602	hsa-miR-711	HITS-CLIP	23824327
MIRT621601	hsa-miR-6081	HITS-CLIP	23824327
MIRT621600	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT621599	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT439139	hsa-let-7c-5p	3'LIFE	25074381
MIRT439139	hsa-let-7c-5p	3'LIFE	25074381
MIRT735672	hsa-miR-423-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCRELISA	34017372
MIRT621606	hsa-miR-1295b-5p	HITS-CLIP	23824327
MIRT621605	hsa-miR-1912	HITS-CLIP	23824327
MIRT621604	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT621603	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT621602	hsa-miR-711	HITS-CLIP	23824327
MIRT621601	hsa-miR-6081	HITS-CLIP	23824327
MIRT621600	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT621599	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT1477126	hsa-miR-1204	CLIP-seq
MIRT1477127	hsa-miR-1273	CLIP-seq
MIRT1477128	hsa-miR-129-5p	CLIP-seq
MIRT1477129	hsa-miR-1324	CLIP-seq
MIRT1477130	hsa-miR-153	CLIP-seq
MIRT1477131	hsa-miR-186	CLIP-seq
MIRT1477132	hsa-miR-3133	CLIP-seq
MIRT1477133	hsa-miR-3154	CLIP-seq
MIRT1477134	hsa-miR-3174	CLIP-seq
MIRT1477135	hsa-miR-3183	CLIP-seq
MIRT1477136	hsa-miR-342-5p	CLIP-seq
MIRT1477137	hsa-miR-3606	CLIP-seq
MIRT1477138	hsa-miR-3616-3p	CLIP-seq
MIRT1477139	hsa-miR-371-3p	CLIP-seq
MIRT1477140	hsa-miR-4434	CLIP-seq
MIRT1477141	hsa-miR-4508	CLIP-seq
MIRT1477142	hsa-miR-4516	CLIP-seq
MIRT1477143	hsa-miR-4648	CLIP-seq
MIRT1477144	hsa-miR-4651	CLIP-seq
MIRT1477145	hsa-miR-4664-5p	CLIP-seq
MIRT1477146	hsa-miR-4721	CLIP-seq
MIRT1477147	hsa-miR-4723-3p	CLIP-seq
MIRT1477148	hsa-miR-4757-5p	CLIP-seq
MIRT1477149	hsa-miR-4786-5p	CLIP-seq
MIRT1477150	hsa-miR-587	CLIP-seq
MIRT1477151	hsa-miR-608	CLIP-seq
MIRT1477152	hsa-miR-663b	CLIP-seq
MIRT1477153	hsa-miR-769-5p	CLIP-seq
MIRT1477154	hsa-miR-875-5p	CLIP-seq
MIRT1477155	hsa-miR-921	CLIP-seq
MIRT1477156	hsa-miR-939	CLIP-seq
MIRT1477157	hsa-miR-1185	CLIP-seq
MIRT1477158	hsa-miR-1207-5p	CLIP-seq
MIRT1477128	hsa-miR-129-5p	CLIP-seq
MIRT1477159	hsa-miR-1321	CLIP-seq
MIRT1477129	hsa-miR-1324	CLIP-seq
MIRT1477160	hsa-miR-137	CLIP-seq
MIRT1477161	hsa-miR-25	CLIP-seq
MIRT1477135	hsa-miR-3183	CLIP-seq
MIRT1477162	hsa-miR-32	CLIP-seq
MIRT1477163	hsa-miR-363	CLIP-seq
MIRT1477164	hsa-miR-367	CLIP-seq
MIRT1477165	hsa-miR-3679-5p	CLIP-seq
MIRT1477166	hsa-miR-4270	CLIP-seq
MIRT1477167	hsa-miR-4441	CLIP-seq
MIRT1477168	hsa-miR-4640-5p	CLIP-seq
MIRT1477147	hsa-miR-4723-3p	CLIP-seq
MIRT1477169	hsa-miR-4726-5p	CLIP-seq
MIRT1477170	hsa-miR-4739	CLIP-seq
MIRT1477171	hsa-miR-4756-5p	CLIP-seq
MIRT1477172	hsa-miR-4763-3p	CLIP-seq
MIRT1477154	hsa-miR-875-5p	CLIP-seq
MIRT1477173	hsa-miR-92a	CLIP-seq
MIRT1477174	hsa-miR-92b	CLIP-seq
MIRT1477158	hsa-miR-1207-5p	CLIP-seq
MIRT1477134	hsa-miR-3174	CLIP-seq
MIRT1477137	hsa-miR-3606	CLIP-seq
MIRT1477139	hsa-miR-371-3p	CLIP-seq
MIRT2364025	hsa-miR-3918	CLIP-seq
MIRT1477141	hsa-miR-4508	CLIP-seq
MIRT2364026	hsa-miR-4512	CLIP-seq
MIRT2364027	hsa-miR-4736	CLIP-seq
MIRT1477148	hsa-miR-4757-5p	CLIP-seq
MIRT1477172	hsa-miR-4763-3p	CLIP-seq
MIRT1477155	hsa-miR-921	CLIP-seq
MIRT1477157	hsa-miR-1185	CLIP-seq
MIRT1477158	hsa-miR-1207-5p	CLIP-seq
MIRT1477159	hsa-miR-1321	CLIP-seq
MIRT2657747	hsa-miR-3141	CLIP-seq
MIRT1477165	hsa-miR-3679-5p	CLIP-seq
MIRT2657748	hsa-miR-3691-3p	CLIP-seq
MIRT1477166	hsa-miR-4270	CLIP-seq
MIRT1477167	hsa-miR-4441	CLIP-seq
MIRT1477170	hsa-miR-4739	CLIP-seq
MIRT1477171	hsa-miR-4756-5p	CLIP-seq
MIRT1477172	hsa-miR-4763-3p	CLIP-seq
MIRT2657749	hsa-miR-4779	CLIP-seq
MIRT2657750	hsa-miR-765	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
EPAS1	Unknown	23991099

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000430	Process	Regulation of transcription from RNA polymerase II promoter by glucose	IC	8576131
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	8576131
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	7852331
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1589769, 8954795
GO:0005515	Function	Protein binding	IPI	19505873, 25416956
GO:0005634	Component	Nucleus	IDA	8576131, 15358760
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007595	Process	Lactation	IEA
GO:0010255	Process	Glucose mediated signaling pathway	IEA
GO:0010255	Process	Glucose mediated signaling pathway	IMP	7852331
GO:0019086	Process	Late viral transcription	IC	8576131
GO:0042803	Function	Protein homodimerization activity	IPI	8576131
GO:0043425	Function	BHLH transcription factor binding	IPI	8576131
GO:0043565	Function	Sequence-specific DNA binding	IDA	8576131
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	7852331, 8576131
GO:0046982	Function	Protein heterodimerization activity	IPI	8576131
GO:0046983	Function	Protein dimerization activity	IEA
GO:0055088	Process	Lipid homeostasis	IEA
GO:0055088	Process	Lipid homeostasis	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IMP	7852331
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600390	12594	ENSG00000105698

Q15853

Protein name

Upstream stimulatory factor 2 (Class B basic helix-loop-helix protein 12) (bHLHb12) (FOS-interacting protein) (FIP) (Major late transcription factor 2) (Upstream transcription factor 2)

Protein function

Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters.

PDB

8IA3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	236 → 291	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD
GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA
VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH
NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ

Sequence length

346

Interactions

View interactions

	Reactome
			Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15864740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28202377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11241666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19354068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36171428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33203678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26427878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16186802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	18970934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	32109289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30244169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19089909, 25149140, 37564208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24274472, 30388826, 31661772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	36104591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23280316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	18970934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20814220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36303872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	20814220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18165439, 26453052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	18165439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18165439, 26453052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23280018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	11058604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	16109978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	24378567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	24378567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36104591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal Perforation	BEFREE	29844331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	16629180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	16629180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33001025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16330554, 25149140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25149140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25149140	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16330554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22693540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30244169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24274472, 30388826, 31661772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15276216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19730683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28150532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10523835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18230803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	BEFREE	8954795		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	11583024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19074828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	19074828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11241666, 16010690, 16186802, 31013770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15276216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	16186802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12403649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15864740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23280018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	40102295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19730683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19730683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19730683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	24378567		★★★★★ ★☆☆☆☆ Found in Text Mining only

USF2 (upstream transcription factor 2, c-fos interacting)