USF1 (upstream transcription factor 1)

Gene

• Entrez ID: 7391
• Gene name: Upstream transcription factor 1
• Gene symbol: USF1
• Synonyms (NCBI Gene): FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gen

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2073658	C>T	Risk-factor	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045419	hsa-miR-149-5p	CLASH	23622248
MIRT040599	hsa-miR-92b-3p	CLASH	23622248
MIRT038834	hsa-miR-93-3p	CLASH	23622248
MIRT1477105	hsa-miR-1285	CLIP-seq
MIRT1477106	hsa-miR-3187-5p	CLIP-seq
MIRT1477107	hsa-miR-4731-5p	CLIP-seq
MIRT1477108	hsa-miR-612	CLIP-seq
MIRT1477109	hsa-miR-1252	CLIP-seq
MIRT1477110	hsa-miR-147b	CLIP-seq
MIRT1477111	hsa-miR-210	CLIP-seq
MIRT1477112	hsa-miR-3151	CLIP-seq
MIRT1477113	hsa-miR-338-3p	CLIP-seq
MIRT1477114	hsa-miR-33a	CLIP-seq
MIRT1477115	hsa-miR-33b	CLIP-seq
MIRT1477116	hsa-miR-34a	CLIP-seq
MIRT1477117	hsa-miR-34c-5p	CLIP-seq
MIRT1477118	hsa-miR-4289	CLIP-seq
MIRT1477119	hsa-miR-4457	CLIP-seq
MIRT1477120	hsa-miR-449a	CLIP-seq
MIRT1477121	hsa-miR-449b	CLIP-seq
MIRT1477122	hsa-miR-4530	CLIP-seq
MIRT1477123	hsa-miR-4688	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT1477125	hsa-miR-586	CLIP-seq
MIRT2364009	hsa-miR-1229	CLIP-seq
MIRT2364010	hsa-miR-193a-3p	CLIP-seq
MIRT2364011	hsa-miR-193b	CLIP-seq
MIRT2364012	hsa-miR-198	CLIP-seq
MIRT2364013	hsa-miR-3591-5p	CLIP-seq
MIRT2364014	hsa-miR-3657	CLIP-seq
MIRT2364015	hsa-miR-3926	CLIP-seq
MIRT2364016	hsa-miR-4323	CLIP-seq
MIRT2364017	hsa-miR-4436a	CLIP-seq
MIRT2364018	hsa-miR-4669	CLIP-seq
MIRT2364019	hsa-miR-4700-3p	CLIP-seq
MIRT2364020	hsa-miR-4712-5p	CLIP-seq
MIRT2364021	hsa-miR-548s	CLIP-seq
MIRT2364022	hsa-miR-648	CLIP-seq
MIRT2364023	hsa-miR-770-5p	CLIP-seq
MIRT2364024	hsa-miR-149	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT1477105	hsa-miR-1285	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477110	hsa-miR-147b	CLIP-seq
MIRT2364012	hsa-miR-198	CLIP-seq
MIRT1477111	hsa-miR-210	CLIP-seq
MIRT1477106	hsa-miR-3187-5p	CLIP-seq
MIRT1477113	hsa-miR-338-3p	CLIP-seq
MIRT1477114	hsa-miR-33a	CLIP-seq
MIRT1477115	hsa-miR-33b	CLIP-seq
MIRT2364013	hsa-miR-3591-5p	CLIP-seq
MIRT2657744	hsa-miR-3622a-3p	CLIP-seq
MIRT2657745	hsa-miR-3622b-3p	CLIP-seq
MIRT2364014	hsa-miR-3657	CLIP-seq
MIRT1477118	hsa-miR-4289	CLIP-seq
MIRT2364016	hsa-miR-4323	CLIP-seq
MIRT2364017	hsa-miR-4436a	CLIP-seq
MIRT1477122	hsa-miR-4530	CLIP-seq
MIRT2364018	hsa-miR-4669	CLIP-seq
MIRT2364019	hsa-miR-4700-3p	CLIP-seq
MIRT2364020	hsa-miR-4712-5p	CLIP-seq
MIRT1477107	hsa-miR-4731-5p	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT2657746	hsa-miR-545	CLIP-seq
MIRT1477125	hsa-miR-586	CLIP-seq
MIRT1477108	hsa-miR-612	CLIP-seq
MIRT2364022	hsa-miR-648	CLIP-seq
MIRT2364023	hsa-miR-770-5p	CLIP-seq
MIRT1477105	hsa-miR-1285	CLIP-seq
MIRT2462988	hsa-miR-1343	CLIP-seq
MIRT1477110	hsa-miR-147b	CLIP-seq
MIRT2364012	hsa-miR-198	CLIP-seq
MIRT1477111	hsa-miR-210	CLIP-seq
MIRT1477106	hsa-miR-3187-5p	CLIP-seq
MIRT1477113	hsa-miR-338-3p	CLIP-seq
MIRT1477114	hsa-miR-33a	CLIP-seq
MIRT1477115	hsa-miR-33b	CLIP-seq
MIRT2364013	hsa-miR-3591-5p	CLIP-seq
MIRT2657744	hsa-miR-3622a-3p	CLIP-seq
MIRT2657745	hsa-miR-3622b-3p	CLIP-seq
MIRT2364014	hsa-miR-3657	CLIP-seq
MIRT1477118	hsa-miR-4289	CLIP-seq
MIRT2364016	hsa-miR-4323	CLIP-seq
MIRT2364017	hsa-miR-4436a	CLIP-seq
MIRT1477122	hsa-miR-4530	CLIP-seq
MIRT2364018	hsa-miR-4669	CLIP-seq
MIRT2364019	hsa-miR-4700-3p	CLIP-seq
MIRT2364020	hsa-miR-4712-5p	CLIP-seq
MIRT1477107	hsa-miR-4731-5p	CLIP-seq
MIRT1477124	hsa-miR-486-3p	CLIP-seq
MIRT2657746	hsa-miR-545	CLIP-seq
MIRT1477125	hsa-miR-586	CLIP-seq
MIRT1477108	hsa-miR-612	CLIP-seq
MIRT2364022	hsa-miR-648	CLIP-seq
MIRT2364023	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000430	Process	Regulation of transcription from RNA polymerase II promoter by glucose	IC	8576131
GO:0000430	Process	Regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	ISS
GO:0000785	Component	Chromatin	IDA	27141965
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	2249772
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	8576131, 18234320
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	7852331
GO:0001666	Process	Response to hypoxia	IMP	12917334
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	19303849, 25416956, 27141965, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	2249772, 8576131, 15358760, 18234320
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	19303849
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	2249772
GO:0009411	Process	Response to UV	IEA
GO:0009411	Process	Response to UV	ISS
GO:0010255	Process	Glucose mediated signaling pathway	IEA
GO:0010255	Process	Glucose mediated signaling pathway	IMP	7852331
GO:0019086	Process	Late viral transcription	IDA	2249772
GO:0019899	Function	Enzyme binding	IPI	19303849
GO:0019901	Function	Protein kinase binding	IPI	19303849
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0042593	Process	Glucose homeostasis	TAS	15054483
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IPI	8576131
GO:0042826	Function	Histone deacetylase binding	IPI	19303849
GO:0043425	Function	BHLH transcription factor binding	IPI	8576131
GO:0043565	Function	Sequence-specific DNA binding	IDA	2249772, 8576131
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	27141965
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	7852331, 8576131, 18234320
GO:0045990	Process	Carbon catabolite regulation of transcription	TAS	19303849
GO:0046982	Function	Protein heterodimerization activity	IPI	8576131
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051918	Process	Negative regulation of fibrinolysis	IC	18234320
GO:0055088	Process	Lipid homeostasis	IEA
GO:0055088	Process	Lipid homeostasis	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IMP	7852331
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 191523
• HGNC: 12593
• e!Ensembl: ENSG00000158773

Protein

• UniProt ID: P22415
• Protein name: Upstream stimulatory factor 1 (Class B basic helix-loop-helix protein 11) (bHLHb11) (Major late transcription factor 1)
• Protein function: Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters.
• PDB: 1AN4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	200 → 255	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
  YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
  STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP
  RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
  GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
  LEVVIKNDSN

• Sequence length: 310

Pathways

Reactome:

Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOVASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA, COMBINED, 1	—	ClinVar, Disgenet, GenCC ClinVar, Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA, FAMILIAL COMBINED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, familial combined, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15864740		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11241666		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22390463	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15175273, 17885212, 18276913, 19910639, 24722012, 26068452, 26819196, 30545366		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31670516		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15175273, 17885212, 18276913, 19910639, 24722012, 26068452, 26819196, 30545366		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	17885212, 18276913		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18276913, 19910639, 24722012, 26068452	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	25374392	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	22390463	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10523835, 12857727, 30183375		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35414770	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25149140, 25480412	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39993614	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29322800		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16699592, 17885212, 18974842, 24722012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16699592, 17885212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16699592, 18974842, 24722012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	29598907		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31565837		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16249459		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21284881		★☆☆☆☆ Found in Text Mining only
Complement Component C1s Deficiency	Complement component deficiency	Pubtator	31537905	Associate	★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome ib	Congenital myasthenic syndrome	Pubtator	12393509	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17673701, 18276913, 18577828, 19910639, 20031629, 26819196, 31725952		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17673701, 18276913, 18577828, 19910639, 20031629, 26068452, 26819196, 31725952		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17673701		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18276913, 19910639, 26068452	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18276913, 18577828, 18974842, 31725952	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17673701, 18276913, 18577828, 18974842, 19910639, 20031629, 26819196, 31725952		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18276913		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18220935		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18220935		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18445538	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15175273, 16132950, 16186412, 16531745, 16936202, 18445538, 18593823, 18758746, 21814221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down syndrome	Pubtator	11415440	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	16680034, 17885212, 19750004, 20031629, 26819196		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	18303204, 19910639	Associate	★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	11058604		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	12377807	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29441861		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35287174	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29441861		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30743215		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32776110, 35287174	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31337730	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	17196209		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11252174, 31725952		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	17065663		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	16699592, 16936202, 17065663, 18230803, 18276913, 18303204, 18445538, 18577828, 19750004, 31725952	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	11252174, 14991056, 15175273, 15959806, 15976322, 16132950, 16531745, 16680034, 16699592, 16936202, 16938803, 17065663, 17483372, 17673701, 17885212, 18276913, 18445538, 18577828, 18593823, 18758746, 19750004, 22460558, 24811296, 25308402, 26819196, 31725952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	LHGDN	14991056, 15959806, 15976322, 16076849, 16531745, 17673701		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	17196209		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18067551	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31040655		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	25374392	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29598907		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	16572591	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31537905	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16330554, 25149140, 25367853, 25480412		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25149140	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16330554		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12403649		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17999073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10523835, 12857727, 30183375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29322800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31468594, 31822580		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19730683		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12857727, 25480412, 30542391		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21284881		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10523835		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27649659, 29871931		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27649659	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18230803, 18303204	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20054229	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16132950, 18097648, 18220935, 19995791, 20054229		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	7478537		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25277193	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11241666, 16010690, 25395235, 31565837		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16572591	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	16126374	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	10528238		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	10528238		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	25374392		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15864740		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	10528238		★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	17065663, 18220935, 25308402		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18303204	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19995791, 30545366		★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	18067551	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30233704		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	16126374, 32269179	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29322800		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26052935		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24175814, 34533293, 39385481	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	22390463		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30931936		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31468594, 31822580		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31468594, 40102295	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19730683		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19730683		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19730683	Associate	★☆☆☆☆ Found in Text Mining only