Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7388
Gene name	Ubiquinol-cytochrome c reductase hinge protein
Gene symbol	UQCRH
Synonyms (NCBI Gene)	MC3DN11QCR6UQCR8
Chromosome	1
Chromosome location	1p33

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT459019	hsa-miR-4463	PAR-CLIP	23592263
MIRT459018	hsa-miR-1272	PAR-CLIP	23592263
MIRT459017	hsa-miR-4778-5p	PAR-CLIP	23592263
MIRT459016	hsa-miR-1245b-3p	PAR-CLIP	23592263
MIRT459015	hsa-miR-4502	PAR-CLIP	23592263
MIRT459014	hsa-miR-7155-5p	PAR-CLIP	23592263
MIRT459013	hsa-miR-342-5p	PAR-CLIP	23592263
MIRT459012	hsa-miR-4664-5p	PAR-CLIP	23592263
MIRT459011	hsa-miR-4651	PAR-CLIP	23592263
MIRT459010	hsa-miR-608	PAR-CLIP	23592263
MIRT459009	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT459008	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT459007	hsa-miR-6737-5p	PAR-CLIP	23592263
MIRT459006	hsa-miR-6812-5p	PAR-CLIP	23592263
MIRT459005	hsa-miR-6819-5p	PAR-CLIP	23592263
MIRT459004	hsa-miR-4762-3p	PAR-CLIP	23592263
MIRT459019	hsa-miR-4463	PAR-CLIP	23592263
MIRT459018	hsa-miR-1272	PAR-CLIP	23592263
MIRT459017	hsa-miR-4778-5p	PAR-CLIP	23592263
MIRT459016	hsa-miR-1245b-3p	PAR-CLIP	23592263
MIRT459015	hsa-miR-4502	PAR-CLIP	23592263
MIRT459014	hsa-miR-7155-5p	PAR-CLIP	23592263
MIRT459013	hsa-miR-342-5p	PAR-CLIP	23592263
MIRT459012	hsa-miR-4664-5p	PAR-CLIP	23592263
MIRT459011	hsa-miR-4651	PAR-CLIP	23592263
MIRT459010	hsa-miR-608	PAR-CLIP	23592263
MIRT459009	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT459008	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT459007	hsa-miR-6737-5p	PAR-CLIP	23592263
MIRT459006	hsa-miR-6812-5p	PAR-CLIP	23592263
MIRT459005	hsa-miR-6819-5p	PAR-CLIP	23592263
MIRT459004	hsa-miR-4762-3p	PAR-CLIP	23592263
MIRT1476729	hsa-miR-3678-3p	CLIP-seq
MIRT1476730	hsa-miR-376a	CLIP-seq
MIRT1476731	hsa-miR-376b	CLIP-seq
MIRT1476732	hsa-miR-4760-5p	CLIP-seq
MIRT1476733	hsa-miR-522	CLIP-seq
MIRT1476734	hsa-miR-548aa	CLIP-seq
MIRT1476730	hsa-miR-376a	CLIP-seq
MIRT1476731	hsa-miR-376b	CLIP-seq
MIRT2143642	hsa-miR-376c	CLIP-seq
MIRT2143643	hsa-miR-4317	CLIP-seq
MIRT2143644	hsa-miR-634	CLIP-seq
MIRT2363834	hsa-miR-1206	CLIP-seq
MIRT2363835	hsa-miR-1273d	CLIP-seq
MIRT2363836	hsa-miR-3607-5p	CLIP-seq
MIRT2143642	hsa-miR-376c	CLIP-seq
MIRT2143643	hsa-miR-4317	CLIP-seq
MIRT1476732	hsa-miR-4760-5p	CLIP-seq
MIRT2363837	hsa-miR-582-5p	CLIP-seq
MIRT2363838	hsa-miR-600	CLIP-seq
MIRT2143644	hsa-miR-634	CLIP-seq
MIRT2143642	hsa-miR-376c	CLIP-seq
MIRT2143643	hsa-miR-4317	CLIP-seq
MIRT1476732	hsa-miR-4760-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006119	Process	Oxidative phosphorylation	TAS	2826252
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	IBA
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	IEA
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	NAS	28844695
GO:0008121	Function	Quinol-cytochrome-c reductase activity	IMP	34750991
GO:0008121	Function	Quinol-cytochrome-c reductase activity	TAS	2826252
GO:0009060	Process	Aerobic respiration	TAS	2826252
GO:0016020	Component	Membrane	IEA
GO:0045275	Component	Respiratory chain complex III	IBA
GO:0045333	Process	Cellular respiration	NAS	28844695
GO:0098803	Component	Respiratory chain complex	IEA
GO:0098803	Component	Respiratory chain complex	TAS	2826252
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
613844	12590	ENSG00000173660

P07919

Protein name

Cytochrome b-c1 complex subunit 6, mitochondrial (Complex III subunit 6) (Complex III subunit VIII) (Cytochrome c1 non-heme 11 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c reductase complex 11 kDa protein)

Protein function

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complex

PDB

5XTE , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02320	UCR_hinge	28 → 91	Ubiquinol-cytochrome C reductase hinge protein	Family

Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSR
SHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX III DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX III DEFICIENCY, NUCLEAR TYPE 11	—	ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO ClinVar, Disgenet, GenCC, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	33942972	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21901141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28332314, 36105252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34133843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33942972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	33942972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34133843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28332314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	38181234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12881716, 7684318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21901141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28332314, 7684318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24156912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24156912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	24204994	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36901944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12881716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28714002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	38181234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UQCRH (ubiquinol-cytochrome c reductase hinge protein)