Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7386
Gene name	Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
Gene symbol	UQCRFS1
Synonyms (NCBI Gene)	MC3DN10RIP1RIS1RISPUQCR5
Chromosome	19
Chromosome location	19q12

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1242465339	G>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs1568344751	C>G	Pathogenic	Splice acceptor variant

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006517	hsa-miR-155-5p	Luciferase reporter assayWestern blot	20550618
MIRT006517	hsa-miR-155-5p	Luciferase reporter assayWestern blot	20550618
MIRT050913	hsa-miR-17-5p	CLASH	23622248
MIRT044309	hsa-miR-106b-5p	CLASH	23622248
MIRT039761	hsa-miR-615-3p	CLASH	23622248
MIRT500595	hsa-miR-23c	PAR-CLIP	20371350
MIRT500594	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT500593	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT500592	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT500591	hsa-miR-10a-3p	PAR-CLIP	20371350
MIRT500590	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT500589	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT500588	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT565071	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT565070	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT565069	hsa-miR-421	PAR-CLIP	20371350
MIRT500587	hsa-miR-548aw	PAR-CLIP	20371350
MIRT500586	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT500585	hsa-miR-527	PAR-CLIP	20371350
MIRT500584	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT500595	hsa-miR-23c	PAR-CLIP	24398324
MIRT500594	hsa-miR-130a-5p	PAR-CLIP	24398324
MIRT500593	hsa-miR-23b-3p	PAR-CLIP	24398324
MIRT500592	hsa-miR-23a-3p	PAR-CLIP	24398324
MIRT500591	hsa-miR-10a-3p	PAR-CLIP	24398324
MIRT500590	hsa-miR-409-3p	PAR-CLIP	24398324
MIRT500589	hsa-miR-33a-3p	PAR-CLIP	24398324
MIRT500588	hsa-miR-205-3p	PAR-CLIP	24398324
MIRT500587	hsa-miR-548aw	PAR-CLIP	24398324
MIRT500586	hsa-miR-518a-5p	PAR-CLIP	24398324
MIRT500585	hsa-miR-527	PAR-CLIP	24398324
MIRT500584	hsa-miR-450b-5p	PAR-CLIP	24398324
MIRT500595	hsa-miR-23c	PAR-CLIP	20371350
MIRT500594	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT500593	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT500592	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT500591	hsa-miR-10a-3p	PAR-CLIP	20371350
MIRT500590	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT500589	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT500588	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT565071	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT565070	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT565069	hsa-miR-421	PAR-CLIP	20371350
MIRT500587	hsa-miR-548aw	PAR-CLIP	20371350
MIRT500586	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT500585	hsa-miR-527	PAR-CLIP	20371350
MIRT500584	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT500595	hsa-miR-23c	PAR-CLIP	24398324
MIRT500594	hsa-miR-130a-5p	PAR-CLIP	24398324
MIRT500593	hsa-miR-23b-3p	PAR-CLIP	24398324
MIRT500592	hsa-miR-23a-3p	PAR-CLIP	24398324
MIRT500591	hsa-miR-10a-3p	PAR-CLIP	24398324
MIRT500590	hsa-miR-409-3p	PAR-CLIP	24398324
MIRT500589	hsa-miR-33a-3p	PAR-CLIP	24398324
MIRT500588	hsa-miR-205-3p	PAR-CLIP	24398324
MIRT500587	hsa-miR-548aw	PAR-CLIP	24398324
MIRT500586	hsa-miR-518a-5p	PAR-CLIP	24398324
MIRT500585	hsa-miR-527	PAR-CLIP	24398324
MIRT500584	hsa-miR-450b-5p	PAR-CLIP	24398324
MIRT1476697	hsa-miR-1257	CLIP-seq
MIRT1476698	hsa-miR-1297	CLIP-seq
MIRT1476699	hsa-miR-132	CLIP-seq
MIRT1476700	hsa-miR-212	CLIP-seq
MIRT1476701	hsa-miR-23a	CLIP-seq
MIRT1476702	hsa-miR-23b	CLIP-seq
MIRT1476703	hsa-miR-26a	CLIP-seq
MIRT1476704	hsa-miR-26b	CLIP-seq
MIRT1476705	hsa-miR-3136-5p	CLIP-seq
MIRT1476706	hsa-miR-3183	CLIP-seq
MIRT1476707	hsa-miR-3671	CLIP-seq
MIRT1476708	hsa-miR-371-5p	CLIP-seq
MIRT1476709	hsa-miR-371b-5p	CLIP-seq
MIRT1476710	hsa-miR-4272	CLIP-seq
MIRT1476711	hsa-miR-4439	CLIP-seq
MIRT1476712	hsa-miR-4465	CLIP-seq
MIRT1476713	hsa-miR-4477a	CLIP-seq
MIRT1476714	hsa-miR-4513	CLIP-seq
MIRT1476715	hsa-miR-4711-3p	CLIP-seq
MIRT1476716	hsa-miR-4720-3p	CLIP-seq
MIRT1476717	hsa-miR-4723-3p	CLIP-seq
MIRT1476718	hsa-miR-4762-5p	CLIP-seq
MIRT1476719	hsa-miR-4766-5p	CLIP-seq
MIRT1476720	hsa-miR-4804-3p	CLIP-seq
MIRT1476721	hsa-miR-499-3p	CLIP-seq
MIRT1476722	hsa-miR-499a-3p	CLIP-seq
MIRT1476723	hsa-miR-511	CLIP-seq
MIRT1476724	hsa-miR-516a-3p	CLIP-seq
MIRT1476725	hsa-miR-520f	CLIP-seq
MIRT1476726	hsa-miR-548l	CLIP-seq
MIRT1476727	hsa-miR-600	CLIP-seq
MIRT1476728	hsa-miR-607	CLIP-seq
MIRT1476698	hsa-miR-1297	CLIP-seq
MIRT1476701	hsa-miR-23a	CLIP-seq
MIRT1476702	hsa-miR-23b	CLIP-seq
MIRT1476703	hsa-miR-26a	CLIP-seq
MIRT1476704	hsa-miR-26b	CLIP-seq
MIRT1476706	hsa-miR-3183	CLIP-seq
MIRT1476707	hsa-miR-3671	CLIP-seq
MIRT1476708	hsa-miR-371-5p	CLIP-seq
MIRT1476709	hsa-miR-371b-5p	CLIP-seq
MIRT1476712	hsa-miR-4465	CLIP-seq
MIRT1476717	hsa-miR-4723-3p	CLIP-seq
MIRT1476718	hsa-miR-4762-5p	CLIP-seq
MIRT1476721	hsa-miR-499-3p	CLIP-seq
MIRT1476722	hsa-miR-499a-3p	CLIP-seq
MIRT1476724	hsa-miR-516a-3p	CLIP-seq
MIRT1476727	hsa-miR-600	CLIP-seq
MIRT1476728	hsa-miR-607	CLIP-seq
MIRT1476698	hsa-miR-1297	CLIP-seq
MIRT1476699	hsa-miR-132	CLIP-seq
MIRT1476700	hsa-miR-212	CLIP-seq
MIRT1476701	hsa-miR-23a	CLIP-seq
MIRT1476702	hsa-miR-23b	CLIP-seq
MIRT1476703	hsa-miR-26a	CLIP-seq
MIRT1476704	hsa-miR-26b	CLIP-seq
MIRT1476705	hsa-miR-3136-5p	CLIP-seq
MIRT1476706	hsa-miR-3183	CLIP-seq
MIRT1476707	hsa-miR-3671	CLIP-seq
MIRT1476708	hsa-miR-371-5p	CLIP-seq
MIRT1476709	hsa-miR-371b-5p	CLIP-seq
MIRT1476711	hsa-miR-4439	CLIP-seq
MIRT1476712	hsa-miR-4465	CLIP-seq
MIRT1476714	hsa-miR-4513	CLIP-seq
MIRT1476715	hsa-miR-4711-3p	CLIP-seq
MIRT1476716	hsa-miR-4720-3p	CLIP-seq
MIRT1476717	hsa-miR-4723-3p	CLIP-seq
MIRT1476718	hsa-miR-4762-5p	CLIP-seq
MIRT1476720	hsa-miR-4804-3p	CLIP-seq
MIRT1476721	hsa-miR-499-3p	CLIP-seq
MIRT1476722	hsa-miR-499a-3p	CLIP-seq
MIRT1476723	hsa-miR-511	CLIP-seq
MIRT1476724	hsa-miR-516a-3p	CLIP-seq
MIRT1476725	hsa-miR-520f	CLIP-seq
MIRT1476728	hsa-miR-607	CLIP-seq
MIRT1476698	hsa-miR-1297	CLIP-seq
MIRT1476703	hsa-miR-26a	CLIP-seq
MIRT1476704	hsa-miR-26b	CLIP-seq
MIRT1476706	hsa-miR-3183	CLIP-seq
MIRT1476707	hsa-miR-3671	CLIP-seq
MIRT1476708	hsa-miR-371-5p	CLIP-seq
MIRT1476709	hsa-miR-371b-5p	CLIP-seq
MIRT1476712	hsa-miR-4465	CLIP-seq
MIRT1476717	hsa-miR-4723-3p	CLIP-seq
MIRT1476724	hsa-miR-516a-3p	CLIP-seq
MIRT2657676	hsa-miR-3691-3p	CLIP-seq
MIRT2657677	hsa-miR-627	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23168492, 27499296, 28380382, 33961781
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	31883641
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	IBA
GO:0008121	Function	Quinol-cytochrome-c reductase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IBA
GO:0022904	Process	Respiratory electron transport chain	IMP	31883641
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0034551	Process	Mitochondrial respiratory chain complex III assembly	IMP	31883641
GO:0045275	Component	Respiratory chain complex III	IBA
GO:0045275	Component	Respiratory chain complex III	IC	31883641
GO:0045275	Component	Respiratory chain complex III	IDA	23168492
GO:0045275	Component	Respiratory chain complex III	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051537	Function	2 iron, 2 sulfur cluster binding	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
191327	12587	ENSG00000169021

P47985

Protein name

Cytochrome b-c1 complex subunit Rieske, mitochondrial (EC 7.1.1.8) (Complex III subunit 5) (Cytochrome b-c1 complex subunit 5) (Rieske iron-sulfur protein) (RISP) (Rieske protein UQCRFS1) (Ubiquinol-cytochrome c reductase iron-sulfur subunit) [Cleaved int

Protein function

[Cytochrome b-c1 complex subunit Rieske, mitochondrial]: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylati

PDB

5XTE , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09165	Ubiq-Cytc-red_N	2 → 76	Ubiquinol-cytochrome c reductase 8 kDa, N-terminal	Domain
PF02921	UCR_TM	80 → 145	Ubiquinol cytochrome reductase transmembrane region	Family
PF00355	Rieske	153 → 264	Rieske [2Fe-2S] domain	Domain

Sequence

MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG

Sequence length

274

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Efferocytosis Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cardiomyopathy	Pathogenic	rs1568344751, rs1242465339, rs1568346416	RCV000758256 RCV000758562 RCV000758565	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lactic acidosis	Pathogenic	rs1568344751, rs1242465339	RCV000758256 RCV000758562	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mitochondrial complex III deficiency, nuclear type 10	Pathogenic	rs1568344751, rs1242465339, rs1568346416	RCV001003400 RCV001003402 RCV001003401	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Propionic acidemia	Pathogenic	rs1568344751, rs1242465339	RCV000758256 RCV000758562	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX III DEFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (77)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28300832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31661557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	28087739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35432724, 35788655	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	28504706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25563840, 30842407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31101885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15047214, 16280139, 21383699, 28404866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21901141, 22433433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21282461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27738385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27845902	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12821338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	31883641	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic heart failure	Heart Failure	BEFREE	28454582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25906152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28087739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28454582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27845902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28396243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22355661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25277242, 29844685, 31545498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19435890, 22469979, 25880091, 28404866, 29274253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19435890, 22469979, 23972990, 25880091, 28404866, 29274253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19435890, 28108311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11921281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29047093, 30710505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	39513914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30356849		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	28288569, 30796198, 31661557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated complex III deficiency	Isolated Complex III Deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27748372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25144719, 27748372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27699664, 31429854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31429854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29844685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15047214, 16280139, 21383699, 28404866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25277242, 29844685, 31545498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27738385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12821338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18253734, 29312502, 29464045, 30423296, 31223438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27035122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16280139, 21822305, 25277242, 25724678, 26446169, 29535128, 31223438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25906152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15047214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16280139, 21901141		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25724678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Complex III Deficiency	Mitochondrial complex deficiency	Pubtator	31883641	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27845902, 31883641, 39513914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23595117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12086877, 16280139, 16737913, 20438712, 21124841, 25277242, 28087739, 29514082, 31101885, 31545498, 31661557, 31706322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26575016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30796198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23456625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12821338		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17620309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34439877, 37221238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18253734, 29312502, 29464045, 30423296, 31223438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	31239269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18253734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28504706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28288569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31506635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30423296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Propionic acidemia	Propionic acidemia	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Refractory anemias	Anemia	BEFREE	7715611, 8931868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28466458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28466458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	7715611, 8931868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30735454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23313255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27035122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37221238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28579326, 28744127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26733177, 27476169		★★★★★ ★☆☆☆☆ Found in Text Mining only

UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)