Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7379
Gene name	Uroplakin 2
Gene symbol	UPK2
Synonyms (NCBI Gene)	UP2UPII
Chromosome	11
Chromosome location	11q23.3
Summary	This gene encodes one of the proteins of the highly conserved urothelium-specific integral membrane proteins of the asymmetric unit membrane which forms urothelium apical plaques in mammals. The asymmetric unit membrane is believed to strengthen the uroth

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT490873	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT490872	hsa-miR-4779	PAR-CLIP	23592263
MIRT490871	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490869	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490870	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490868	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490867	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT490866	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT490865	hsa-miR-4459	PAR-CLIP	23592263
MIRT490864	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT490863	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT490862	hsa-miR-1301-5p	PAR-CLIP	23592263
MIRT490860	hsa-miR-6502-5p	PAR-CLIP	23592263
MIRT490861	hsa-miR-765	PAR-CLIP	23592263
MIRT490859	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT490857	hsa-miR-6822-3p	PAR-CLIP	23592263
MIRT490858	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT490856	hsa-miR-8085	PAR-CLIP	23592263
MIRT490855	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490854	hsa-miR-3175	PAR-CLIP	23592263
MIRT490853	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT490873	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT490872	hsa-miR-4779	PAR-CLIP	23592263
MIRT490871	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490869	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490870	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490868	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490867	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT490866	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT490865	hsa-miR-4459	PAR-CLIP	23592263
MIRT490864	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT490863	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT490862	hsa-miR-1301-5p	PAR-CLIP	23592263
MIRT490860	hsa-miR-6502-5p	PAR-CLIP	23592263
MIRT490861	hsa-miR-765	PAR-CLIP	23592263
MIRT490859	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT490857	hsa-miR-6822-3p	PAR-CLIP	23592263
MIRT490858	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT490856	hsa-miR-8085	PAR-CLIP	23592263
MIRT490855	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490854	hsa-miR-3175	PAR-CLIP	23592263
MIRT490853	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT1476309	hsa-miR-122	CLIP-seq
MIRT1476310	hsa-miR-1252	CLIP-seq
MIRT1476311	hsa-miR-1275	CLIP-seq
MIRT1476312	hsa-miR-1321	CLIP-seq
MIRT1476313	hsa-miR-1827	CLIP-seq
MIRT1476314	hsa-miR-2392	CLIP-seq
MIRT1476315	hsa-miR-3125	CLIP-seq
MIRT1476316	hsa-miR-3126-5p	CLIP-seq
MIRT1476317	hsa-miR-3202	CLIP-seq
MIRT1476318	hsa-miR-3659	CLIP-seq
MIRT1476319	hsa-miR-3660	CLIP-seq
MIRT1476320	hsa-miR-3662	CLIP-seq
MIRT1476321	hsa-miR-3689a-3p	CLIP-seq
MIRT1476322	hsa-miR-3689c	CLIP-seq
MIRT1476323	hsa-miR-3916	CLIP-seq
MIRT1476324	hsa-miR-4316	CLIP-seq
MIRT1476325	hsa-miR-4419a	CLIP-seq
MIRT1476326	hsa-miR-4420	CLIP-seq
MIRT1476327	hsa-miR-4428	CLIP-seq
MIRT1476328	hsa-miR-4488	CLIP-seq
MIRT1476329	hsa-miR-4510	CLIP-seq
MIRT1476330	hsa-miR-4525	CLIP-seq
MIRT1476331	hsa-miR-4526	CLIP-seq
MIRT1476332	hsa-miR-4533	CLIP-seq
MIRT1476333	hsa-miR-4650-5p	CLIP-seq
MIRT1476334	hsa-miR-4665-5p	CLIP-seq
MIRT1476335	hsa-miR-4697-5p	CLIP-seq
MIRT1476336	hsa-miR-4710	CLIP-seq
MIRT1476337	hsa-miR-4714-5p	CLIP-seq
MIRT1476338	hsa-miR-4723-5p	CLIP-seq
MIRT1476339	hsa-miR-4728-5p	CLIP-seq
MIRT1476340	hsa-miR-4739	CLIP-seq
MIRT1476341	hsa-miR-4756-5p	CLIP-seq
MIRT1476342	hsa-miR-4795-3p	CLIP-seq
MIRT1476343	hsa-miR-625	CLIP-seq
MIRT1476344	hsa-miR-637	CLIP-seq
MIRT1476345	hsa-miR-661	CLIP-seq
MIRT2143507	hsa-miR-342-5p	CLIP-seq
MIRT1476319	hsa-miR-3660	CLIP-seq
MIRT2143508	hsa-miR-4433	CLIP-seq
MIRT2143509	hsa-miR-4481	CLIP-seq
MIRT1476331	hsa-miR-4526	CLIP-seq
MIRT2143510	hsa-miR-4651	CLIP-seq
MIRT2143511	hsa-miR-4664-5p	CLIP-seq
MIRT1476337	hsa-miR-4714-5p	CLIP-seq
MIRT2143512	hsa-miR-4745-5p	CLIP-seq
MIRT2143513	hsa-miR-608	CLIP-seq
MIRT2143507	hsa-miR-342-5p	CLIP-seq
MIRT1476319	hsa-miR-3660	CLIP-seq
MIRT2143508	hsa-miR-4433	CLIP-seq
MIRT2143509	hsa-miR-4481	CLIP-seq
MIRT1476331	hsa-miR-4526	CLIP-seq
MIRT2143510	hsa-miR-4651	CLIP-seq
MIRT2143511	hsa-miR-4664-5p	CLIP-seq
MIRT1476337	hsa-miR-4714-5p	CLIP-seq
MIRT2143512	hsa-miR-4745-5p	CLIP-seq
MIRT2143513	hsa-miR-608	CLIP-seq
MIRT2143507	hsa-miR-342-5p	CLIP-seq
MIRT1476319	hsa-miR-3660	CLIP-seq
MIRT2143508	hsa-miR-4433	CLIP-seq
MIRT2143509	hsa-miR-4481	CLIP-seq
MIRT1476331	hsa-miR-4526	CLIP-seq
MIRT2143510	hsa-miR-4651	CLIP-seq
MIRT2143511	hsa-miR-4664-5p	CLIP-seq
MIRT1476337	hsa-miR-4714-5p	CLIP-seq
MIRT2143512	hsa-miR-4745-5p	CLIP-seq
MIRT2143513	hsa-miR-608	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8175808
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0030855	Process	Epithelial cell differentiation	IBA
GO:0030855	Process	Epithelial cell differentiation	IDA	10514386
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
611558	12579	ENSG00000110375

O00526

Protein name

Uroplakin-2 (UP2) (Uroplakin II) (UPII)

Protein function

Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07353	Uroplakin_II	6 → 184	Uroplakin II	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in ureter. {ECO:0000269|PubMed:9846985}.

Sequence

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATL
MVRRANDSKVVTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYL
VKKGTATESSREIPMSTLPRRNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALAL
GSRK

Sequence length

184

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEMATURIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	30061246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12097284, 14963492, 18440837, 18485461, 19322012, 22218302, 24121102, 25085582, 27600610, 27622605, 27687590, 28781650, 28789701, 30403777, 30627578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27642214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27642214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30061246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	27642214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14963492, 18440837, 18485461, 19322012, 22218302, 23908596, 24121102, 25085582, 27600610, 27622605, 27687590, 28781650, 28789701, 30403777, 30627578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	10404304, 10458411, 9846985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	29465304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29021814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29021814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28448891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16691580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14963492, 18440837, 18485461, 19322012, 22218302, 23908596, 24121102, 25085582, 27600610, 27622605, 27687590, 28781650, 28789701, 30403777, 30627578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10955799, 12792753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10955799, 22218302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	34944460	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	9515818		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	10404304, 20501863, 23908596, 9515818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12792753, 23908596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10404304, 10458411, 25085582, 27687590, 28388658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	34944460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27642214, 28786878		★★★★★ ★☆☆☆☆ Found in Text Mining only

UPK2 (uroplakin 2)