Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7378
Gene name	Uridine phosphorylase 1
Gene symbol	UPP1
Synonyms (NCBI Gene)	UDRPASEUPUPASEUPP
Chromosome	7
Chromosome location	7p12.3
Summary	This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2`- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage

Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024540	hsa-miR-215-5p	Microarray	19074876
MIRT026152	hsa-miR-192-5p	Microarray	19074876
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT2363723	hsa-miR-578	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFKB1	Activation	20544543
RELA	Activation	20544543
STAT1	Activation	20544543

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004850	Function	Uridine phosphorylase activity	IBA
GO:0004850	Function	Uridine phosphorylase activity	IDA	7488099
GO:0004850	Function	Uridine phosphorylase activity	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006139	Process	Nucleobase-containing compound metabolic process	TAS	7488099
GO:0006218	Process	Uridine catabolic process	IBA
GO:0006218	Process	Uridine catabolic process	IDA	7488099
GO:0006218	Process	Uridine catabolic process	IEA
GO:0006220	Process	Pyrimidine nucleotide metabolic process	IEA
GO:0006248	Process	CMP catabolic process	IEA
GO:0006249	Process	DCMP catabolic process	IEA
GO:0009032	Function	Thymidine phosphorylase activity	IEA
GO:0009116	Process	Nucleoside metabolic process	IEA
GO:0009166	Process	Nucleotide catabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016763	Function	Pentosyltransferase activity	IEA
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042802	Function	Identical protein binding	IPI	19291308, 20856879
GO:0044206	Process	UMP salvage	IEA
GO:0046050	Process	UMP catabolic process	IEA
GO:0046074	Process	DTMP catabolic process	IEA
GO:0046079	Process	DUMP catabolic process	IEA
GO:0046108	Process	Uridine metabolic process	IEA
GO:0047847	Function	Deoxyuridine phosphorylase activity	IEA

MIM	HGNC	e!Ensembl
191730	12576	ENSG00000183696

Q16831

Protein name

Uridine phosphorylase 1 (UPase 1) (UrdPase 1) (EC 2.4.2.3)

Protein function

Catalyzes the reversible phosphorylytic cleavage of uridine to uracil and ribose-1-phosphate which can then be utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis (PubMed:7488099). Shows broad subs

PDB

3EUE , 3EUF , 3NBQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01048	PNP_UDP_1	54 → 304	Phosphorylase superfamily	Domain

Sequence

MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA

Sequence length

310

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism		Pyrimidine salvage Pyrimidine catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15060742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23275889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11401323, 11807789, 31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31496029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	9818021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29964038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15060742, 16525674, 29964038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35354355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	32377607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	28688579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	26391545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26391545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26391545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	26391545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36290884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40348204	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32583596, 33498463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17707461	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31496029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11401323, 31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17214321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11401323, 20226755, 31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	12115385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11401323, 12084455, 12359357, 15060742, 17471022, 31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15714138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30706174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30559182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17214321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	17214321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17214321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31496029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31496029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	16525674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17707461	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34498424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UPP1 (uridine phosphorylase 1)