Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7369
Gene name	Uromodulin
Gene symbol	UMOD
Synonyms (NCBI Gene)	ADMCKD2ADTKD1FJHNHNFJHNFJ1MCKD2THGPTHP
Chromosome	16
Chromosome location	16p12.3
Summary	The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situat

Show/Hide all (35)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28934582	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs28934583	A>C,G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs28934584	C>A,G,T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs121917768	C>G,T	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121917769	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121917770	T>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121917771	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121917772	A>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121917773	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121917774	C>A	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs398122388	C>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs398123697	C>A,T	Conflicting-interpretations-of-pathogenicity, pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs398123698	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs750535100	G>A,T	Likely-pathogenic	Missense variant, synonymous variant, non coding transcript variant, coding sequence variant
rs780462125	A>T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs878855325	CTTCGGGGCAGA>AGGAGGCGG	Pathogenic	Non coding transcript variant, inframe indel, coding sequence variant
rs886043751	G>A,C,T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant, synonymous variant, stop gained
rs1057515585	C>A,T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant, missense variant
rs1057522004	T>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1060499657	T>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1447458978	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1555486021	C>T	Likely-pathogenic	Missense variant, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs1555487316	A>C	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1555487318	T>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1555487528	GCGCCAGTACTCGTCCAGGGTGCGGTG>-	Pathogenic	Inframe deletion, non coding transcript variant, coding sequence variant
rs1555487621	A>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1555487726	C>T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1567309582	C>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1567309965	C>T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1567310019	G>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1567310155	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1567311279	A>T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1567311288	A>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1596560944	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1596561934	G>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant

Show/Hide all (12)

miRTarBase ID	miRNA	Experiments
MIRT1474911	hsa-miR-1538	CLIP-seq
MIRT1474912	hsa-miR-193a-3p	CLIP-seq
MIRT1474913	hsa-miR-193b	CLIP-seq
MIRT1474914	hsa-miR-4313	CLIP-seq
MIRT1474915	hsa-miR-4745-3p	CLIP-seq
MIRT2462902	hsa-miR-330-3p	CLIP-seq
MIRT2462903	hsa-miR-3714	CLIP-seq
MIRT2462904	hsa-miR-3929	CLIP-seq
MIRT2462905	hsa-miR-4419b	CLIP-seq
MIRT2462906	hsa-miR-4422	CLIP-seq
MIRT2462907	hsa-miR-4478	CLIP-seq
MIRT2462908	hsa-miR-940	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HNF1B	Activation	18846391

Show/Hide all (89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IDA	20172860
GO:0001822	Process	Kidney development	IEA
GO:0002251	Process	Organ or tissue specific immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003091	Process	Renal water homeostasis	IEA
GO:0003094	Process	Glomerular filtration	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32045104, 32616672
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IDA	20172860
GO:0005929	Component	Cilium	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006883	Process	Intracellular sodium ion homeostasis	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006968	Process	Cellular defense response	TAS	2409603
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007029	Process	Endoplasmic reticulum organization	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	20798515
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	20798515
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	2409603
GO:0008380	Process	RNA splicing	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009414	Process	Response to water deprivation	IEA
GO:0009986	Component	Cell surface	IBA
GO:0010467	Process	Gene expression	IEA
GO:0015747	Process	Urate transport	IEA
GO:0016020	Component	Membrane	IDA	2249987
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	7028707, 20798515
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	7028707, 18025791, 20798515
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019864	Function	IgG binding	IDA	20798515
GO:0019898	Component	Extrinsic component of membrane	TAS	7873609
GO:0030643	Process	Intracellular phosphate ion homeostasis	IEA
GO:0030644	Process	Intracellular chloride ion homeostasis	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0033555	Process	Multicellular organismal response to stress	IEA
GO:0034620	Process	Cellular response to unfolded protein	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035809	Process	Regulation of urine volume	IEA
GO:0036503	Process	ERAD pathway	IEA
GO:0042995	Component	Cell projection	IEA
GO:0044861	Process	Protein transport into plasma membrane raft	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046720	Process	Citric acid secretion	IEA
GO:0048871	Process	Multicellular organismal-level homeostasis	IEA
GO:0048878	Process	Chemical homeostasis	IEA
GO:0050801	Process	Monoatomic ion homeostasis	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	32616672
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050891	Process	Multicellular organismal-level water homeostasis	IEA
GO:0051223	Process	Regulation of protein transport	IEA
GO:0055062	Process	Phosphate ion homeostasis	IEA
GO:0055064	Process	Chloride ion homeostasis	IEA
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0055075	Process	Potassium ion homeostasis	IEA
GO:0055078	Process	Sodium ion homeostasis	IEA
GO:0060073	Process	Micturition	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070294	Process	Renal sodium ion absorption	IEA
GO:0071918	Process	Urea transmembrane transport	IEA
GO:0072044	Process	Collecting duct development	IEA
GO:0072051	Process	Juxtaglomerular apparatus development	IEA
GO:0072070	Process	Loop of Henle development	IEA
GO:0072218	Process	Metanephric ascending thin limb development	IEA
GO:0072221	Process	Metanephric distal convoluted tubule development	IEA
GO:0072233	Process	Metanephric thick ascending limb development	IEA
GO:0072665	Process	Protein localization to vacuole	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097709	Process	Connective tissue replacement	IEA
GO:0097744	Process	Renal urate salt excretion	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0140367	Process	Antibacterial innate immune response	IDA	32616672
GO:1990266	Process	Neutrophil migration	IBA
GO:1990266	Process	Neutrophil migration	IDA	20798515

MIM	HGNC	e!Ensembl
191845	12559	ENSG00000169344

P07911

Protein name

Uromodulin (Tamm-Horsfall urinary glycoprotein) (THP) [Cleaved into: Uromodulin, secreted form]

Protein function

[Uromodulin]: Functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in t

PDB

4WRN , 6TQK , 6TQL , 6ZS5 , 6ZYA , 7PFP , 7Q3N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12947	EGF_3	31 → 63	EGF domain	Domain
PF07645	EGF_CA	65 → 106	Calcium-binding EGF domain	Domain
PF07645	EGF_CA	108 → 161	Calcium-binding EGF domain	Domain
PF00100	Zona_pellucida	335 → 583	Zona pellucida-like domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the tubular cells of the kidney. Most abundant protein in normal urine (at protein level). Synthesized exclusively in the kidney. Expressed exclusively by epithelial cells of the thick ascending limb of Henle's loop (TALH)

Sequence

MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDG
LTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC
HALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTL
DEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDE
GIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEEC
SIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMY
LSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIK
INFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLS
TEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVEN
GESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLN
LGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ

Sequence length

640

Interactions

View interactions

	Reactome
			Asparagine N-linked glycosylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant medullary cystic kidney disease with or without hyperuricemia	Likely pathogenic; Pathogenic	rs780475918, rs878855325, rs398123697, rs766919534, rs1197633531, rs1965755740	RCV005250201 RCV001328178 RCV001328229 RCV001328181 RCV001328230 RCV001328180 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial juvenile hyperuricemic nephropathy type 1	Likely pathogenic; Pathogenic	rs1596552335, rs2141676976, rs2141676533, rs2141676232, rs781101544, rs2141676543, rs780475918, rs747592262, rs1555487621, rs2507390389, rs2507391033, rs878855325, rs2507391645, rs2507391567, rs886043751 View all (40 more)	RCV002251411 RCV002251410 RCV002251414 RCV002251418 RCV002251421 View all (55 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
UMOD-related disorder	Pathogenic; Likely pathogenic	rs886043751, rs1555487528, rs28934584, rs2507389035, rs1567310155, rs1057522004, rs1447458978	RCV004535399 RCV004739301 RCV004528105 RCV004534209 RCV004531830 RCV004725215 RCV004527688 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT TUBULOINTERSTITIAL KIDNEY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic kidney disease	Conflicting classifications of pathogenicity	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHRONIC KIDNEY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential hypertension	association	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDRONEPHROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIC NEPHROPATHY, FAMILIAL JUVENILE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney failure	Uncertain significance	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBULOINTERSTITIAL KIDNEY DISEASE, AUTOSOMAL DOMINANT 1	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (180)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
2,8-Dihydroxyadenine Urolithiasis	2,8-Dihydroxyadenine Urolithiasis	BEFREE	24961278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31257404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28721806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28613246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28721806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40033250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	20151160	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Sickle Cell	Sickle cell anemia	Pubtator	35456398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29061362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	17351635, 21946309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17351635, 21946309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29388563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19959715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	10330352, 18651238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19959715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	30622431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	15649945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bartter syndrome antenatal type 1	Bartter syndrome	Pubtator	8377383	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29512924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30220055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	18846391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29512924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24302177, 26901863, 39348357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31128026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26683887, 36004630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28598953, 29698955, 30903163, 31205055, 31257404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30903163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28721806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial nephritis	Interstitial Nephritis	BEFREE	14569098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12787393, 14531790, 15327389, 17245395, 19203555, 21980298, 22034507, 22947327, 23880785, 25163389, 27938332, 28609449, 29784615, 30454063, 31124979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15327389, 19430482, 19959715, 20075439, 20686651, 20948228, 21071970, 21235779, 21332338, 21654721, 21738052, 21903317, 21980298, 22143329, 22237754 View all (21 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ciliopathies	Ciliopathies	BEFREE	23880785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31411505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36443444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	20151160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28242751, 30903163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21235779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21235779, 28089453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21235779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	LHGDN	11730273, 12471200, 14531790, 17010121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	GENOMICS_ENGLAND_DG	29180396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20686651, 21332338, 25163389, 28089453, 28151855, 28858977, 30158836, 31411505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	29703844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20686651, 21332338, 25163389, 28089453, 28151855, 28858977, 29806965, 30158836, 31205055, 31411505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20686651, 25163389, 26683888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28242751	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	29703844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29578190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30482755, 31003921, 31253490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21738052, 27448670, 28151855, 29578190, 29779026, 30892596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29703844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29578190, 29703844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21738052, 28182086, 28592554, 28779365, 29578190, 29779026, 30311395, 30482755		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28779365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29882279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	31172225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31286759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31286759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	24324041		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Essential Hypertension	Hypertension	Pubtator	26617860, 32555714	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Essential Hypertension	Hypertension	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Fabry Disease	Fabry disease	LHGDN	18651238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	18651238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	24961278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32792518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28119080, 29543748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulocystic Kidney Disease with Hyperuricemia and Isosthenuria	Glomerulocystic Kidney Disease With Hyperuricemia And Isosthenuria	UNIPROT_DG	14570709, 17010121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulocystic Kidney Disease with Hyperuricemia and Isosthenuria	Glomerulocystic Kidney Disease With Hyperuricemia And Isosthenuria	GENOMICS_ENGLAND_DG	15983957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulocystic Kidney Disease with Hyperuricemia and Isosthenuria	Glomerulocystic Kidney Disease With Hyperuricemia And Isosthenuria	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulocystic Kidney Disease with Hyperuricemia and Isosthenuria	Glomerulocystic Kidney Disease With Hyperuricemia And Isosthenuria	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31725735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	38154551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	29935159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	17245395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	12787393, 20151160, 20686651, 21332338, 23723338, 28894234, 30376835, 32847529, 35456398, 39216982, 40300987	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	28242751, 30903163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28242751	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	10966501, 12234310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	30641516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20686651, 21082022, 25163389, 26683887, 26683888, 27938332, 29578190, 34593962, 35446786, 36443444, 40300987	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	28242751	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	16982955, 20686651, 21082022, 21654721, 21738052, 24185693, 24324041, 25163389, 25228753, 26966016, 27139155, 27938332, 28151855, 28418009, 28598953 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	GWASDB_DG	21082022		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	GWASCAT_DG	21082022, 27618447		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22228705		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hypertensive nephropathy	Hypertensive Nephropathy	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	10330352, 12787393, 15673476, 20151160, 21060763, 21868615, 23344472, 23723338, 25671765, 39216982, 40300987	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	12471200, 12787393, 12832729, 14570709, 15253706, 17065110, 17245395, 18349750, 20151160, 21071970, 21903317, 21978600, 22157498, 25228753, 25417683 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	LHGDN	15589826, 17065110, 18409531		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	GWASCAT_DG	29124443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemic Nephropathy, Familial Juvenile 1	Hyperuricemic Nephropathy	BEFREE	11675411, 12629136, 12832729, 12900848, 14531790, 14569098, 14570709, 15073494, 15086896, 15253706, 15673476, 15844001, 15983957, 15989109, 16164624 View all (22 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemic Nephropathy, Familial Juvenile 1	Hyperuricemic Nephropathy	UNIPROT_DG	12471200, 12629136, 12900848, 14569098, 14570709, 15086896, 15575003, 15983957, 17010121, 21060763, 22776760, 23197950, 23988501, 25436415		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemic Nephropathy, Familial Juvenile 1	Hyperuricemic Nephropathy	GENOMICS_ENGLAND_DG	14569098, 15983957		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemic Nephropathy, Familial Juvenile 1	Hyperuricemic Nephropathy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemic Nephropathy, Familial Juvenile 1	Hyperuricemic Nephropathy	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic hypercalciuria	Hypercalciuria	BEFREE	29353465		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	25163389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	33048330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	LHGDN	18455532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29974381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	20686651, 20728256, 25228753, 27898524, 28605509, 28781372, 29353465, 30007527, 30649494, 31205055, 8179291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12471200, 12634862, 15327389, 16883323, 17245395, 19430482, 20686651, 20948228, 21654721, 22143329, 22157498, 22237754, 23748428, 23826568, 23880785 View all (17 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	12471200, 16883323, 18651238, 18846391, 19430482, 20686651, 21868615, 22034507, 23826568, 24670410, 25163389, 25436415, 25540096, 25671765, 25786455 View all (15 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	LHGDN	15327389, 16164624		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	19430482, 8486146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	12787393, 14569098, 14570709, 15253706, 15327389, 17065110, 17151335, 20151160, 22034507, 22157498, 25228753, 25818408, 28325753, 31157132		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Kidney Failure Chronic	Kidney failure	Pubtator	12787393, 15253706, 15327389, 20151160, 21980298, 22034507, 23723338, 25786455, 27938332, 28609449, 30376835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27898524, 28613246, 29058155, 30552306, 31411505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12787393, 14531790, 15327389, 17245395, 19203555, 20807609, 21980298, 22034507, 22947327, 23880785, 25163389, 25417683, 27938332, 28609449, 29784615, 30454063, 31124979 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	20686651, 26831199, 29124443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASDB_DG	20686651		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28721806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26220344, 27470583, 29200853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	9526736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31411505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21332338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21332338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21332338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21332338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30220055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31286759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	9526736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31128026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29512924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22052706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	31376563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary cystic kidney disease 1	Medullary Cystic Kidney Disease	BEFREE	10966501, 11261687, 12832729, 16883323, 21868615, 25738250, 25818408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary Cystic Kidney Disease Type 2	Medullary Cystic Kidney Disease	BEFREE	12471200, 12900848, 14569098, 15073494, 15844001, 15989109, 18846391, 18950917, 30976393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary Cystic Kidney Disease Type 2	Medullary Cystic Kidney Disease	UNIPROT_DG	12471200, 14531790, 14570709, 17010121, 25436415, 27729211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary Cystic Kidney Disease Type 2	Medullary Cystic Kidney Disease	GENOMICS_ENGLAND_DG	14569098, 15983957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary Cystic Kidney Disease Type 2	Medullary Cystic Kidney Disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary Cystic Kidney Disease Type 2	Medullary Cystic Kidney Disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31505464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple renal cysts	Multiple renal cysts	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple small medullary renal cysts	Multiple small medullary renal cysts	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36004630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31128026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	21868615, 32764335, 35165522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	12832729, 14531790, 19203555, 20378641, 21654721, 21868615, 21978600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	14531790, 19203555, 20378641, 21654721, 21868615, 21978600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	20686651, 20728256, 25228753, 27898524, 28605509, 28781372, 29353465, 30007527, 30649494, 31205055, 8179291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	Pubtator	27036738	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	Pubtator	28361944	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephronophthisis	Nephronophthisis	BEFREE	10330352, 11261687, 12234310, 12634862, 14570709, 15086896, 16164624, 18846391, 21868615, 23880785, 25738250, 26037636, 26040415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis 1	Nephronophthisis	BEFREE	12234310, 26037636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	31725199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22580740	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31128026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14644315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	34469896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30376835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	17245395, 30376835, 38154551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	15989109, 30552306, 30976393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal corticomedullary cysts	Renal corticomedullary cysts	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal dysplasia and retinal aplasia (disorder)	Renal dysplasia and retinal aplasia	BEFREE	24961278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28325753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	17065110, 17151335, 20151160, 23748428, 26040415, 7921753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19797158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31172225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36790659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	38154551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
UMOD-related autosomal dominant tubulointerstitial kidney disease	Tubulointerstitial Kidney Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	27193112, 30715578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	17245395, 28605509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	Pubtator	28361944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	28585182, 29361765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28522271		★★★★★ ★☆☆☆☆ Found in Text Mining only

UMOD (uromodulin)