UCP3 (uncoupling protein 3)

Gene

• Entrez ID: 7352
• Gene name: Uncoupling protein 3
• Gene symbol: UCP3
• Synonyms (NCBI Gene): SLC25A9
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proto

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2229707	C>T	Benign, pathogenic	Missense variant, coding sequence variant
rs17848368	G>A	Pathogenic	Coding sequence variant, missense variant
rs45476292	C>A,T	Benign, pathogenic	Coding sequence variant, splice donor variant, synonymous variant
rs104894319	G>A	Pathogenic, likely-benign	Coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038202	hsa-miR-342-5p	CLASH	23622248
MIRT1472788	hsa-miR-1301	CLIP-seq
MIRT1472789	hsa-miR-1470	CLIP-seq
MIRT1472790	hsa-miR-193a-5p	CLIP-seq
MIRT1472791	hsa-miR-210	CLIP-seq
MIRT1472792	hsa-miR-214	CLIP-seq
MIRT1472793	hsa-miR-296-5p	CLIP-seq
MIRT1472794	hsa-miR-3158-3p	CLIP-seq
MIRT1472795	hsa-miR-3166	CLIP-seq
MIRT1472796	hsa-miR-34a	CLIP-seq
MIRT1472797	hsa-miR-34c-5p	CLIP-seq
MIRT1472798	hsa-miR-3619-5p	CLIP-seq
MIRT1472799	hsa-miR-3657	CLIP-seq
MIRT1472800	hsa-miR-3663-5p	CLIP-seq
MIRT1472801	hsa-miR-3688-5p	CLIP-seq
MIRT1472802	hsa-miR-3929	CLIP-seq
MIRT1472803	hsa-miR-3944-5p	CLIP-seq
MIRT1472804	hsa-miR-4419b	CLIP-seq
MIRT1472805	hsa-miR-4478	CLIP-seq
MIRT1472806	hsa-miR-449a	CLIP-seq
MIRT1472807	hsa-miR-449b	CLIP-seq
MIRT1472808	hsa-miR-4530	CLIP-seq
MIRT1472809	hsa-miR-4635	CLIP-seq
MIRT1472810	hsa-miR-4660	CLIP-seq
MIRT1472811	hsa-miR-4667-3p	CLIP-seq
MIRT1472812	hsa-miR-4669	CLIP-seq
MIRT1472813	hsa-miR-4716-5p	CLIP-seq
MIRT1472814	hsa-miR-4717-3p	CLIP-seq
MIRT1472815	hsa-miR-5047	CLIP-seq
MIRT1472816	hsa-miR-520d-5p	CLIP-seq
MIRT1472817	hsa-miR-524-5p	CLIP-seq
MIRT1472818	hsa-miR-526b	CLIP-seq
MIRT1472819	hsa-miR-542-5p	CLIP-seq
MIRT1472820	hsa-miR-545	CLIP-seq
MIRT1472821	hsa-miR-578	CLIP-seq
MIRT1472822	hsa-miR-598	CLIP-seq
MIRT1472823	hsa-miR-761	CLIP-seq
MIRT1557259	hsa-miR-1272	CLIP-seq
MIRT1557260	hsa-miR-1827	CLIP-seq
MIRT1557261	hsa-miR-3935	CLIP-seq
MIRT2362882	hsa-miR-130a	CLIP-seq
MIRT2362883	hsa-miR-130b	CLIP-seq
MIRT2362884	hsa-miR-148a	CLIP-seq
MIRT2362885	hsa-miR-148b	CLIP-seq
MIRT2362886	hsa-miR-152	CLIP-seq
MIRT2362887	hsa-miR-19a	CLIP-seq
MIRT2362888	hsa-miR-19b	CLIP-seq
MIRT2362889	hsa-miR-223	CLIP-seq
MIRT2362890	hsa-miR-301a	CLIP-seq
MIRT2362891	hsa-miR-301b	CLIP-seq
MIRT2362892	hsa-miR-30a	CLIP-seq
MIRT2362893	hsa-miR-30b	CLIP-seq
MIRT2362894	hsa-miR-30c	CLIP-seq
MIRT2362895	hsa-miR-30d	CLIP-seq
MIRT2362896	hsa-miR-30e	CLIP-seq
MIRT2362897	hsa-miR-3655	CLIP-seq
MIRT2362898	hsa-miR-3666	CLIP-seq
MIRT2362899	hsa-miR-4295	CLIP-seq
MIRT2362900	hsa-miR-454	CLIP-seq
MIRT2362901	hsa-miR-4697-3p	CLIP-seq
MIRT2362902	hsa-miR-4774-3p	CLIP-seq
MIRT1472820	hsa-miR-545	CLIP-seq
MIRT2434448	hsa-miR-370	CLIP-seq
MIRT2434449	hsa-miR-4740-3p	CLIP-seq
MIRT2434448	hsa-miR-370	CLIP-seq
MIRT2434449	hsa-miR-4740-3p	CLIP-seq
MIRT2434448	hsa-miR-370	CLIP-seq
MIRT2434449	hsa-miR-4740-3p	CLIP-seq
MIRT2362882	hsa-miR-130a	CLIP-seq
MIRT2362883	hsa-miR-130b	CLIP-seq
MIRT2362884	hsa-miR-148a	CLIP-seq
MIRT2362885	hsa-miR-148b	CLIP-seq
MIRT2362886	hsa-miR-152	CLIP-seq
MIRT2362887	hsa-miR-19a	CLIP-seq
MIRT2362888	hsa-miR-19b	CLIP-seq
MIRT2362889	hsa-miR-223	CLIP-seq
MIRT2362890	hsa-miR-301a	CLIP-seq
MIRT2362891	hsa-miR-301b	CLIP-seq
MIRT2362897	hsa-miR-3655	CLIP-seq
MIRT2362898	hsa-miR-3666	CLIP-seq
MIRT2362899	hsa-miR-4295	CLIP-seq
MIRT2362900	hsa-miR-454	CLIP-seq
MIRT2362901	hsa-miR-4697-3p	CLIP-seq
MIRT2656950	hsa-miR-1207-5p	CLIP-seq
MIRT2656951	hsa-miR-4459	CLIP-seq
MIRT2656952	hsa-miR-4722-5p	CLIP-seq
MIRT2656953	hsa-miR-4736	CLIP-seq
MIRT2656954	hsa-miR-4763-3p	CLIP-seq
MIRT2656955	hsa-miR-665	CLIP-seq
MIRT2656950	hsa-miR-1207-5p	CLIP-seq
MIRT2656951	hsa-miR-4459	CLIP-seq
MIRT2656952	hsa-miR-4722-5p	CLIP-seq
MIRT2656953	hsa-miR-4736	CLIP-seq
MIRT2656954	hsa-miR-4763-3p	CLIP-seq
MIRT2656955	hsa-miR-665	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000303	Process	Response to superoxide	IEA
GO:0000303	Process	Response to superoxide	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0005515	Function	Protein binding	IPI	24008843
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	9180264
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS	9196039
GO:0006629	Process	Lipid metabolic process	TAS	10935638
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	TAS	9180264
GO:0009409	Process	Response to cold	IBA
GO:0014823	Process	Response to activity	IEA
GO:0015078	Function	Proton transmembrane transporter activity	IDA	11171965, 12670931
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015085	Function	Calcium ion transmembrane transporter activity	IMP	21775425
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IBA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IDA	11707458
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IDA	9305858, 36114012
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IMP	21775425
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	TAS	9196039
GO:0032868	Process	Response to insulin	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:1901373	Process	Lipid hydroperoxide transport	IEA
GO:1901557	Process	Response to fenofibrate	IEA
GO:1902600	Process	Proton transmembrane transport	IDA	11171965
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	TAS	9196039
GO:1990542	Process	Mitochondrial transmembrane transport	IBA
GO:1990845	Process	Adaptive thermogenesis	IBA

Other IDs

• MIM: 602044
• HGNC: 12519
• e!Ensembl: ENSG00000175564

Protein

• UniProt ID: P55916
• Protein name: Putative mitochondrial transporter UCP3 (Solute carrier family 25 member 9) (Uncoupling protein-3) (UCP 3)
• Protein function: Putative transmembrane transporter that plays a role in mitochondrial metabolism via an as yet unclear mechanism (PubMed:21775425, PubMed:36114012). Originally, this mitochondrial protein was thought to act as a proton transmembrane transporter
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	10 → 110	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	112 → 211	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	214 → 305	Mitochondrial carrier protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Only in skeletal muscle and heart (PubMed:9305858). Also expressed in white and brown adipose tissues (PubMed:9305858). Is more expressed in glycolytic than in oxidative skeletal muscles. {ECO:0000269|PubMed:9196039, ECO:0000269|PubMed
• Sequence:

  MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG
  VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI
  LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK
  GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV
  VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA
  LMKVQMLRESPF

• Sequence length: 312

Pathways

Reactome:

The fatty acid cycling model
The proton buffering model

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inherited obesity	Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Morbid obesity	Benign	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar CTD, Disgenet CTD, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity, severe, and type II diabetes	Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREDIABETES SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short-rib thoracic dysplasia 13 with or without polydactyly	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UCP3 POLYMORPHISM G/A	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UCP3 POLYMORPHISM, EXON 6 SPLICE DONOR JUNCTION	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UCP3-related disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	14500553		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	LHGDN	15564896		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	10089012, 15564896		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	11920154		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31744213		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28536923		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28536923		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23257779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26304588	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29398371		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19406964		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12145475, 29694982		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23639961		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10382588, 11126413, 12525856, 15120704, 16644712, 18223008, 19413708, 19769793, 21175267, 28281015, 29610263		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10382588, 11126413, 12525856, 12756473, 15120704, 16644712, 18223008, 19413708, 19769793, 21175267, 28281015, 29610263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	17150099, 19369366, 19769793, 9769326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17150099, 19369366, 19769793, 28977211, 9769326	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18167556	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16373902		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11126411, 11126413, 11151767, 11484071, 11723073, 14694206, 15642081, 16384603, 16644712, 17150099, 18223008, 18755175, 19468707, 19769793, 21074158, 21175267, 21751002, 21897112, 23365654, 27089973, 29529994, 29800730, 30374710, 31759989, 9726246, 9769326, 9836527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17571165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15120704		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15120704		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	16373902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	16373902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32028915	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	12677001	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	26332421		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26332421	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12145475, 29694982		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17786284		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	18167556		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18167556	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10027754, 15642081		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29694982		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	16175492		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	11278795		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	17478558		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26304588	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36810017	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29694982		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29372106		★☆☆☆☆ Found in Text Mining only
Malignant Carcinoid Syndrome	Carcinoid tumor of intestine	BEFREE	30056864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	22919386		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	10395193		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	10618503	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22811361	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15978856, 22811361		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23257779	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17786291		★☆☆☆☆ Found in Text Mining only
Myopathies, Nemaline	Myopathy	BEFREE	12677001		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28977211	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24045656		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11587536		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24124336		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29372106		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10027754, 10066417, 10102249, 11126413, 11151767, 11238538, 11381268, 11683368, 11916758, 12153598, 12525856, 12756473, 14694206, 15642081, 15870396, 15910756, 16006788, 16631432, 17502873, 17697059, 17870627, 18059082, 18249216, 18825612, 18956255, 19413708, 19769793, 21544083, 23560041, 24752406, 25533680, 25755013, 25812254, 25895476, 26483159, 28651828, 28704105, 9498661, 9700198, 9726246, 9726596, 9769326, 9836527		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	Pubtator	10102249, 10480626, 10618503, 11683368, 11842047, 12740453, 18234126, 19039313, 19769793, 20054173, 21190973, 21544083, 24174365, 25755013, 28977211, 33372430, 36810017, 9389729, 9769326	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	UNIPROT_DG	9769326		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity Abdominal	Obesity	Pubtator	19769793	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	9769326		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17870627, 21544083		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28536923		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	16741147		★☆☆☆☆ Found in Text Mining only
Porphyria Variegate	Variegate porphyria	Pubtator	20331452	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	22919386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16352674	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29372106		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	16741147		★☆☆☆☆ Found in Text Mining only