Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7351
Gene name	Uncoupling protein 2
Gene symbol	UCP2
Synonyms (NCBI Gene)	BMIQ4SLC25A8UCPH
Chromosome	11
Chromosome location	11q13.4
Summary	Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proto

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs659366	C>T	Risk-factor	Upstream transcript variant
rs371789455	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

216

Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004046	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCR	21146880
MIRT004046	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCR	21146880
MIRT042197	hsa-miR-484	CLASH	23622248
MIRT000330	hsa-miR-133a-3p	Western blot	23988448
MIRT000330	hsa-miR-133a-3p	Western blot	23988448
MIRT494913	hsa-miR-6758-5p	PAR-CLIP	23708386
MIRT494912	hsa-miR-6856-5p	PAR-CLIP	23708386
MIRT494910	hsa-miR-6873-5p	PAR-CLIP	23708386
MIRT494911	hsa-miR-1321	PAR-CLIP	23708386
MIRT494909	hsa-miR-4739	PAR-CLIP	23708386
MIRT494908	hsa-miR-4756-5p	PAR-CLIP	23708386
MIRT494907	hsa-miR-3150b-3p	PAR-CLIP	23708386
MIRT494906	hsa-miR-4784	PAR-CLIP	23708386
MIRT494905	hsa-miR-4419a	PAR-CLIP	23708386
MIRT494904	hsa-miR-4510	PAR-CLIP	23708386
MIRT494903	hsa-miR-6127	PAR-CLIP	23708386
MIRT494902	hsa-miR-6129	PAR-CLIP	23708386
MIRT494901	hsa-miR-6130	PAR-CLIP	23708386
MIRT494900	hsa-miR-6133	PAR-CLIP	23708386
MIRT494899	hsa-miR-139-3p	PAR-CLIP	23708386
MIRT494898	hsa-miR-765	PAR-CLIP	23708386
MIRT494897	hsa-miR-7106-5p	PAR-CLIP	23708386
MIRT494913	hsa-miR-6758-5p	PAR-CLIP	23708386
MIRT494912	hsa-miR-6856-5p	PAR-CLIP	23708386
MIRT494910	hsa-miR-6873-5p	PAR-CLIP	23708386
MIRT494911	hsa-miR-1321	PAR-CLIP	23708386
MIRT494909	hsa-miR-4739	PAR-CLIP	23708386
MIRT494908	hsa-miR-4756-5p	PAR-CLIP	23708386
MIRT494907	hsa-miR-3150b-3p	PAR-CLIP	23708386
MIRT494906	hsa-miR-4784	PAR-CLIP	23708386
MIRT494905	hsa-miR-4419a	PAR-CLIP	23708386
MIRT494904	hsa-miR-4510	PAR-CLIP	23708386
MIRT494903	hsa-miR-6127	PAR-CLIP	23708386
MIRT494902	hsa-miR-6129	PAR-CLIP	23708386
MIRT494901	hsa-miR-6130	PAR-CLIP	23708386
MIRT494900	hsa-miR-6133	PAR-CLIP	23708386
MIRT494899	hsa-miR-139-3p	PAR-CLIP	23708386
MIRT494898	hsa-miR-765	PAR-CLIP	23708386
MIRT494897	hsa-miR-7106-5p	PAR-CLIP	23708386
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT1472729	hsa-miR-1252	CLIP-seq
MIRT1472730	hsa-miR-1286	CLIP-seq
MIRT1472731	hsa-miR-149	CLIP-seq
MIRT1472732	hsa-miR-1587	CLIP-seq
MIRT1472733	hsa-miR-15a	CLIP-seq
MIRT1472734	hsa-miR-15b	CLIP-seq
MIRT1472735	hsa-miR-16	CLIP-seq
MIRT1472736	hsa-miR-188-3p	CLIP-seq
MIRT1472737	hsa-miR-195	CLIP-seq
MIRT1472738	hsa-miR-2110	CLIP-seq
MIRT1472739	hsa-miR-214	CLIP-seq
MIRT1472740	hsa-miR-3064-5p	CLIP-seq
MIRT1472741	hsa-miR-3153	CLIP-seq
MIRT1472742	hsa-miR-3619-5p	CLIP-seq
MIRT1472743	hsa-miR-3652	CLIP-seq
MIRT1472744	hsa-miR-3668	CLIP-seq
MIRT1472745	hsa-miR-378g	CLIP-seq
MIRT1472746	hsa-miR-383	CLIP-seq
MIRT1472747	hsa-miR-3929	CLIP-seq
MIRT1472748	hsa-miR-424	CLIP-seq
MIRT1472749	hsa-miR-4257	CLIP-seq
MIRT1472750	hsa-miR-4271	CLIP-seq
MIRT1472751	hsa-miR-4291	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT1472753	hsa-miR-4417	CLIP-seq
MIRT1472754	hsa-miR-4419b	CLIP-seq
MIRT1472755	hsa-miR-4430	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT1472756	hsa-miR-4478	CLIP-seq
MIRT1472757	hsa-miR-4492	CLIP-seq
MIRT1472758	hsa-miR-4498	CLIP-seq
MIRT1472759	hsa-miR-4505	CLIP-seq
MIRT1472760	hsa-miR-450b-3p	CLIP-seq
MIRT1472761	hsa-miR-4533	CLIP-seq
MIRT1472762	hsa-miR-4536	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT1472763	hsa-miR-4656	CLIP-seq
MIRT1472764	hsa-miR-4675	CLIP-seq
MIRT1472765	hsa-miR-4699-5p	CLIP-seq
MIRT1472766	hsa-miR-4713-3p	CLIP-seq
MIRT1472767	hsa-miR-4722-5p	CLIP-seq
MIRT1472768	hsa-miR-4725-3p	CLIP-seq
MIRT1472769	hsa-miR-4741	CLIP-seq
MIRT1472770	hsa-miR-4747-5p	CLIP-seq
MIRT1472771	hsa-miR-4768-3p	CLIP-seq
MIRT1472772	hsa-miR-4772-5p	CLIP-seq
MIRT1472773	hsa-miR-4787-5p	CLIP-seq
MIRT1472774	hsa-miR-4794	CLIP-seq
MIRT1472775	hsa-miR-486-3p	CLIP-seq
MIRT1472776	hsa-miR-491-5p	CLIP-seq
MIRT1472777	hsa-miR-497	CLIP-seq
MIRT1472778	hsa-miR-532-3p	CLIP-seq
MIRT1472779	hsa-miR-580	CLIP-seq
MIRT1472780	hsa-miR-583	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq
MIRT1472782	hsa-miR-638	CLIP-seq
MIRT1472783	hsa-miR-645	CLIP-seq
MIRT1472784	hsa-miR-761	CLIP-seq
MIRT1472785	hsa-miR-762	CLIP-seq
MIRT1472786	hsa-miR-769-3p	CLIP-seq
MIRT1472787	hsa-miR-922	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT2142344	hsa-miR-105	CLIP-seq
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT2142345	hsa-miR-1246	CLIP-seq
MIRT2142346	hsa-miR-1255a	CLIP-seq
MIRT2142347	hsa-miR-1255b	CLIP-seq
MIRT1472730	hsa-miR-1286	CLIP-seq
MIRT1472731	hsa-miR-149	CLIP-seq
MIRT1472732	hsa-miR-1587	CLIP-seq
MIRT1472739	hsa-miR-214	CLIP-seq
MIRT1472740	hsa-miR-3064-5p	CLIP-seq
MIRT1472742	hsa-miR-3619-5p	CLIP-seq
MIRT1472745	hsa-miR-378g	CLIP-seq
MIRT1472746	hsa-miR-383	CLIP-seq
MIRT1472747	hsa-miR-3929	CLIP-seq
MIRT1472749	hsa-miR-4257	CLIP-seq
MIRT1472751	hsa-miR-4291	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT1472753	hsa-miR-4417	CLIP-seq
MIRT1472754	hsa-miR-4419b	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT1472756	hsa-miR-4478	CLIP-seq
MIRT1472757	hsa-miR-4492	CLIP-seq
MIRT1472758	hsa-miR-4498	CLIP-seq
MIRT1472759	hsa-miR-4505	CLIP-seq
MIRT1472762	hsa-miR-4536	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT1472763	hsa-miR-4656	CLIP-seq
MIRT1472764	hsa-miR-4675	CLIP-seq
MIRT1472765	hsa-miR-4699-5p	CLIP-seq
MIRT1472769	hsa-miR-4741	CLIP-seq
MIRT1472770	hsa-miR-4747-5p	CLIP-seq
MIRT1472772	hsa-miR-4772-5p	CLIP-seq
MIRT1472773	hsa-miR-4787-5p	CLIP-seq
MIRT1472774	hsa-miR-4794	CLIP-seq
MIRT1472775	hsa-miR-486-3p	CLIP-seq
MIRT2142348	hsa-miR-505	CLIP-seq
MIRT1472779	hsa-miR-580	CLIP-seq
MIRT1472780	hsa-miR-583	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq
MIRT1472783	hsa-miR-645	CLIP-seq
MIRT1472784	hsa-miR-761	CLIP-seq
MIRT1472785	hsa-miR-762	CLIP-seq
MIRT1472787	hsa-miR-922	CLIP-seq
MIRT2142344	hsa-miR-105	CLIP-seq
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT1472729	hsa-miR-1252	CLIP-seq
MIRT2142346	hsa-miR-1255a	CLIP-seq
MIRT2142347	hsa-miR-1255b	CLIP-seq
MIRT1472730	hsa-miR-1286	CLIP-seq
MIRT1472731	hsa-miR-149	CLIP-seq
MIRT2362880	hsa-miR-1538	CLIP-seq
MIRT1472732	hsa-miR-1587	CLIP-seq
MIRT1472733	hsa-miR-15a	CLIP-seq
MIRT1472734	hsa-miR-15b	CLIP-seq
MIRT1472735	hsa-miR-16	CLIP-seq
MIRT1472736	hsa-miR-188-3p	CLIP-seq
MIRT1472737	hsa-miR-195	CLIP-seq
MIRT1472739	hsa-miR-214	CLIP-seq
MIRT1472740	hsa-miR-3064-5p	CLIP-seq
MIRT1472742	hsa-miR-3619-5p	CLIP-seq
MIRT1472743	hsa-miR-3652	CLIP-seq
MIRT1472744	hsa-miR-3668	CLIP-seq
MIRT1472745	hsa-miR-378g	CLIP-seq
MIRT1472746	hsa-miR-383	CLIP-seq
MIRT1472747	hsa-miR-3929	CLIP-seq
MIRT1472748	hsa-miR-424	CLIP-seq
MIRT1472749	hsa-miR-4257	CLIP-seq
MIRT1472751	hsa-miR-4291	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT1472753	hsa-miR-4417	CLIP-seq
MIRT1472754	hsa-miR-4419b	CLIP-seq
MIRT1472755	hsa-miR-4430	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT1472756	hsa-miR-4478	CLIP-seq
MIRT1472757	hsa-miR-4492	CLIP-seq
MIRT1472758	hsa-miR-4498	CLIP-seq
MIRT1472759	hsa-miR-4505	CLIP-seq
MIRT1472760	hsa-miR-450b-3p	CLIP-seq
MIRT1472761	hsa-miR-4533	CLIP-seq
MIRT1472762	hsa-miR-4536	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT1472763	hsa-miR-4656	CLIP-seq
MIRT1472764	hsa-miR-4675	CLIP-seq
MIRT1472765	hsa-miR-4699-5p	CLIP-seq
MIRT1472766	hsa-miR-4713-3p	CLIP-seq
MIRT1472767	hsa-miR-4722-5p	CLIP-seq
MIRT1472769	hsa-miR-4741	CLIP-seq
MIRT2362881	hsa-miR-4745-3p	CLIP-seq
MIRT1472770	hsa-miR-4747-5p	CLIP-seq
MIRT1472771	hsa-miR-4768-3p	CLIP-seq
MIRT1472772	hsa-miR-4772-5p	CLIP-seq
MIRT1472773	hsa-miR-4787-5p	CLIP-seq
MIRT1472774	hsa-miR-4794	CLIP-seq
MIRT1472775	hsa-miR-486-3p	CLIP-seq
MIRT1472776	hsa-miR-491-5p	CLIP-seq
MIRT1472777	hsa-miR-497	CLIP-seq
MIRT2142348	hsa-miR-505	CLIP-seq
MIRT1472778	hsa-miR-532-3p	CLIP-seq
MIRT1472779	hsa-miR-580	CLIP-seq
MIRT1472780	hsa-miR-583	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq
MIRT1472782	hsa-miR-638	CLIP-seq
MIRT1472783	hsa-miR-645	CLIP-seq
MIRT1472784	hsa-miR-761	CLIP-seq
MIRT1472785	hsa-miR-762	CLIP-seq
MIRT1472786	hsa-miR-769-3p	CLIP-seq
MIRT1472787	hsa-miR-922	CLIP-seq
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT2142348	hsa-miR-505	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SMAD4	Unknown	21935467
STAT3	Repression	21344490

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000266	Process	Mitochondrial fission	IEA
GO:0000266	Process	Mitochondrial fission	ISS
GO:0000303	Process	Response to superoxide	IEA
GO:0001666	Process	Response to hypoxia	IDA	22292025
GO:0001666	Process	Response to hypoxia	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 27642082
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	9196039
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006096	Process	Glycolytic process	IMP	24395786
GO:0006541	Process	Glutamine metabolic process	IMP	24395786
GO:0006839	Process	Mitochondrial transport	IEA
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IDA	24395786
GO:0009409	Process	Response to cold	IBA
GO:0009749	Process	Response to glucose	IEA
GO:0015078	Function	Proton transmembrane transporter activity	IDA	22524567, 26182433, 33373220
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015108	Function	Chloride transmembrane transporter activity	IDA	22524567, 26182433
GO:0015131	Function	Oxaloacetate transmembrane transporter activity	IDA	24395786
GO:0015140	Function	Malate transmembrane transporter activity	IDA	24395786
GO:0015183	Function	L-aspartate transmembrane transporter activity	IDA	24395786
GO:0015297	Function	Antiporter activity	IDA	24395786
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015740	Process	C4-dicarboxylate transport	IMP	24395786
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IBA
GO:0019003	Function	GDP binding	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	26182433, 33373220
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0061179	Process	Negative regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0070542	Process	Response to fatty acid	IEA
GO:0070778	Process	L-aspartate transmembrane transport	IEA
GO:0071284	Process	Cellular response to lead ion	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071423	Process	Malate transmembrane transport	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	ISS
GO:0097421	Process	Liver regeneration	IEA
GO:0110099	Process	Negative regulation of calcium import into the mitochondrion	IDA	27642082
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28130074
GO:0140787	Function	Phosphate ion uniporter activity	IDA	24395786
GO:1902356	Process	Oxaloacetate(2-) transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	TAS	9054939
GO:1990542	Process	Mitochondrial transmembrane transport	IBA
GO:1990542	Process	Mitochondrial transmembrane transport	IMP	24395786
GO:1990845	Process	Adaptive thermogenesis	IBA

MIM	HGNC	e!Ensembl
601693	12518	ENSG00000175567

P55851

Protein name

Dicarboxylate carrier SLC25A8 (Mitochondrial uncoupling protein 2) (UCP 2) (Solute carrier family 25 member 8) (UCPH)

Protein function

Antiporter that exports dicarboxylate intermediates of the Krebs cycle in exchange for phosphate plus a proton across the inner membrane of mitochondria, a process driven by mitochondrial motive force with an overall impact on glycolysis, glutam

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	10 → 111	Mitochondrial carrier protein	Family
PF00153	Mito_carr	112 → 208	Mitochondrial carrier protein	Family
PF00153	Mito_carr	211 → 301	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult human tissues, including tissues rich in macrophages. Most expressed in white adipose tissue and skeletal muscle. {ECO:0000269|PubMed:9054939}.

Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR
GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL
LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS
PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
ACTSREAPF

Sequence length

309

Interactions

View interactions

	Reactome
			The fatty acid cycling model The proton buffering model

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BODY MASS INDEX QUANTITATIVE TRAIT LOCUS 4	Uncertain significance; Benign; Likely benign; risk factor	ClinVar CTD, ClinVar CTD, ClinVar	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM DUE TO UCP2 DEFICIENCY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM DUE TO UNCOUPLING PROTEIN 2 DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maturity-onset diabetes of the young type 2	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UCP2-related disorder	Conflicting classifications of pathogenicity; Likely benign; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (248)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	12858170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	26765095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31250660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27478826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23124112, 28962872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	28969071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24141050, 29500423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	18192542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	LHGDN	15564896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	10089012, 15564896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	11920154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28683125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28683125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	25944698	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15827742, 15905464, 16487034, 17462780, 18496642, 19531977, 20142250, 21980456, 29163755, 29784903, 30116205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32650679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28069865, 31744213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15827742, 15905464, 16487034, 17462780, 18496642, 19531977, 20142250, 21980456, 29163755, 29784903, 30116205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15905464	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	17462780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27864377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19758361, 29631683, 30160798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Infarction	Brain Infarction	BEFREE	18018477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17052689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	18301432		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	21364658, 21935467, 25960046, 26107945, 26666173, 30446971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21364658, 21935467, 23257779, 26666173, 34146128, 40362341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	30027365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37679327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	39469880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31085159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25512910, 26181366, 27129291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24037916, 26107945, 29113301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29547569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30225723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16487034, 20937264, 23537071, 28901505, 30116205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20937264, 23537071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	15604415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	20937264, 22613561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12858170, 15358091, 22613561, 23621569, 28399045, 28640254, 29163755		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	12858170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	28693257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31085159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31085159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27150070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10760107, 16982633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	10760107, 18940651, 19406964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18413749, 21128330, 26107945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15448008, 18413749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23826253, 26148070, 31461648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21128330, 23826253, 26148070, 33859525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24440978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29085228	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	19065272, 21186003, 27967291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	27967291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18192542, 23537071, 29559841, 29845235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18192542, 23537071, 23639961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18192542, 18301352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18192542, 23537071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19527523, 34883250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17130180, 17555951, 18192542, 23537071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	31461648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28276603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10337857, 10382588, 11126413, 12013805, 12525856, 12797456, 15120704, 15220218, 15562023, 15827742, 15951317, 16021520, 16644712, 17052202, 17462780 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10337857, 10382588, 11126413, 12013805, 12525856, 12797456, 15120704, 15220218, 15562023, 15827742, 15951317, 16021520, 16644712, 17052202, 17462780 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11904148, 12915397, 19527523, 19769793, 20145583, 22613561, 24440978, 25396419, 27615599, 29151065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12690079, 12915397, 15774022, 18192542, 18324929, 18496642, 19137581, 19659999, 20142250, 21029457, 21074158, 21873561, 22533685, 22613561, 23133645 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15654602	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16373902, 29480974, 31479096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10337857, 10382588, 11440717, 12401727, 12690079, 12915397, 14730379, 15220218, 15308133, 15562023, 15642081, 15738989, 16167150, 16487034, 16644712 View all (37 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15562023, 16123366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	16567833, 17701054		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26218518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15120704, 26218518, 30345618, 30988734, 31479096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15120704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	16373902		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	16373902		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	19681913, 22134120, 25396419, 26846204, 30359091, 31218541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25396419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38175638	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	29857139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	30100544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	26666173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	12960023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	12960023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	37047537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	10860543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	15970480, 22395410, 28219837, 31022254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	23151243	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	17502923, 25512910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31811866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	15905464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	28891310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24440978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	30100544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	33888769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	29857139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	27129291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	27129291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23029535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	23008094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17052202, 19556617, 25910810, 29163755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	18167556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18167556, 25910810, 38175638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	18839467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	BEFREE	19065272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10027754, 17052202, 19908126, 23073711, 29493090, 9054939, 9349606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	GENOMICS_ENGLAND_DG	19065272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	27967291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism due to UCP2 deficiency	Hyperinsulinism	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism due to uncoupling protein 2 deficiency	Hyperinsulinism	ORPHANET_DG	19065272, 25733449		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Immediate	Hypersensitivity	Pubtator	32840960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30100544, 40438943	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	29070699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15106800, 15827742, 17462780, 22461387, 24328731, 29163755, 29936692, 30850841, 30995881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15106800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	16685210		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	11246812, 17389707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	17389707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	16741267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	27273589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	27273589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	23434936, 27967291, 28702331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	27967291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	20427509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28042952, 39271430	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28258342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	29151065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28104982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19556617, 23826253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	25482405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20937264, 22613561, 23621569, 29043564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	18242170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28424210, 29563990, 30426490, 30952098, 31071510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	10760107, 16982633		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	18593920, 23069211, 36275699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38077322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26181366, 27129291, 28941178, 9849876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27787720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29857139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24440978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19387457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33125133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	15833942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21364658, 21935467, 25960046, 26107945, 26666173, 30446971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31811866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24037916, 26107945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30160798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18413749, 21935467, 22705884, 22847181, 23748283, 24853548, 25960046, 26542482, 27451963, 28574619, 28962872, 29988383, 30318520, 30538804, 31330574, 31811866 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18413749, 21128330, 26107945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21935467		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18068334, 30664764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28276603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	10395193, 19474719, 23314523, 28351676, 29151065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	16741267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	29151065	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	15905464, 16741267, 20145583, 27301474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	12385772, 14974928, 15905464, 16741267, 24659521, 27301474, 29551973, 9724080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	22995745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17472436, 18332166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	22070905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23257779	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	28771482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30027365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34481515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16021520, 17463068, 19387457, 21857957, 28130201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16021520, 17463068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18192542, 19527523, 23537071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19527523, 28901505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29559841, 29845235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	32553458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21364658, 21935467, 21954358, 24440978, 28258342, 28574619, 28962872, 29758279, 30664764, 30862953, 31028741, 31461648, 31811866		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29857139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	12797456, 21266666, 23132673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	19137581, 23132673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30885735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35531888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12960023, 18301432, 28771482, 30814312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	12960023, 18301432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	15970480, 22395410, 24811405, 27301474, 27794526, 28777914, 30444569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28042952, 28258342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25351290, 25512910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10027754, 10066417, 10102249, 10337857, 10382588, 10837279, 10852469, 11126413, 11381268, 11440717, 12153598, 12401727, 12525856, 12690079, 12746756 View all (61 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	10102249, 10837279, 11904148, 12690079, 12740453, 12915397, 15833942, 16741267, 18234126, 18496642, 19039313, 19137581, 19769793, 20054173, 22533685 View all (11 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	11381268		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	19769793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	14974928, 22568573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	22070905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38292759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21935467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	40269926	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	29928365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23124112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24440978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	15833942	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15634780, 24141050, 24251413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24251413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	24251413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	10837279, 23314523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21557918, 21584501, 23008094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	19681913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20142250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21935467, 24440978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28977211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	34883250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	BEFREE	10440124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31028741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23515048, 28424210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	30995317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19387457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17066476, 22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17066476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17066476, 22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary growth hormone deficiency	Growth Hormone Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	19556617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25574840, 28239813, 28428961, 29887950, 31702042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	35129048	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24440978	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	12797456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	LHGDN	12797456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	10860543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15970480, 22395410, 28219837, 29459774, 30179264, 31022254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23537071	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30296700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	39469880	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25397683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	37098010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26450681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20427509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11600563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	11246812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19387457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32190174, 33125133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29163755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35129048	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	38175638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	35129048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	28370799		★★★★★ ★☆☆☆☆ Found in Text Mining only

UCP2 (uncoupling protein 2)