Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7348
Gene name	Uroplakin 1B
Gene symbol	UPK1B
Synonyms (NCBI Gene)	TSPAN20UPIBUPK1
Chromosome	3
Chromosome location	3q13.32
Summary	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

232

Show/Hide all (232)

miRTarBase ID	miRNA	Experiments
MIRT1476246	hsa-miR-106a	CLIP-seq
MIRT1476247	hsa-miR-106b	CLIP-seq
MIRT1476248	hsa-miR-1224-3p	CLIP-seq
MIRT1476249	hsa-miR-1225-3p	CLIP-seq
MIRT1476250	hsa-miR-1233	CLIP-seq
MIRT1476251	hsa-miR-1234	CLIP-seq
MIRT1476252	hsa-miR-125a-3p	CLIP-seq
MIRT1476253	hsa-miR-150	CLIP-seq
MIRT1476254	hsa-miR-17	CLIP-seq
MIRT1476255	hsa-miR-1913	CLIP-seq
MIRT1476256	hsa-miR-197	CLIP-seq
MIRT1476257	hsa-miR-20a	CLIP-seq
MIRT1476258	hsa-miR-20b	CLIP-seq
MIRT1476259	hsa-miR-302a	CLIP-seq
MIRT1476260	hsa-miR-302b	CLIP-seq
MIRT1476261	hsa-miR-302c	CLIP-seq
MIRT1476262	hsa-miR-302d	CLIP-seq
MIRT1476263	hsa-miR-302e	CLIP-seq
MIRT1476264	hsa-miR-3149	CLIP-seq
MIRT1476265	hsa-miR-3187-3p	CLIP-seq
MIRT1476266	hsa-miR-324-3p	CLIP-seq
MIRT1476267	hsa-miR-3545-3p	CLIP-seq
MIRT1476268	hsa-miR-3663-5p	CLIP-seq
MIRT1476269	hsa-miR-3667-5p	CLIP-seq
MIRT1476270	hsa-miR-3674	CLIP-seq
MIRT1476271	hsa-miR-372	CLIP-seq
MIRT1476272	hsa-miR-373	CLIP-seq
MIRT1476273	hsa-miR-3934	CLIP-seq
MIRT1476274	hsa-miR-3943	CLIP-seq
MIRT1476275	hsa-miR-409-3p	CLIP-seq
MIRT1476276	hsa-miR-4269	CLIP-seq
MIRT1476277	hsa-miR-4435	CLIP-seq
MIRT1476278	hsa-miR-4438	CLIP-seq
MIRT1476279	hsa-miR-4635	CLIP-seq
MIRT1476280	hsa-miR-4680-5p	CLIP-seq
MIRT1476281	hsa-miR-4701-5p	CLIP-seq
MIRT1476282	hsa-miR-4716-5p	CLIP-seq
MIRT1476283	hsa-miR-4722-3p	CLIP-seq
MIRT1476284	hsa-miR-4731-5p	CLIP-seq
MIRT1476285	hsa-miR-4732-5p	CLIP-seq
MIRT1476286	hsa-miR-4735-5p	CLIP-seq
MIRT1476287	hsa-miR-4755-3p	CLIP-seq
MIRT1476288	hsa-miR-4769-3p	CLIP-seq
MIRT1476289	hsa-miR-4775	CLIP-seq
MIRT1476290	hsa-miR-4781-3p	CLIP-seq
MIRT1476291	hsa-miR-4794	CLIP-seq
MIRT1476292	hsa-miR-483-5p	CLIP-seq
MIRT1476293	hsa-miR-5095	CLIP-seq
MIRT1476294	hsa-miR-5096	CLIP-seq
MIRT1476295	hsa-miR-512-3p	CLIP-seq
MIRT1476296	hsa-miR-519d	CLIP-seq
MIRT1476297	hsa-miR-520a-3p	CLIP-seq
MIRT1476298	hsa-miR-520b	CLIP-seq
MIRT1476299	hsa-miR-520c-3p	CLIP-seq
MIRT1476300	hsa-miR-520d-3p	CLIP-seq
MIRT1476301	hsa-miR-520e	CLIP-seq
MIRT1476302	hsa-miR-520g	CLIP-seq
MIRT1476303	hsa-miR-520h	CLIP-seq
MIRT1476304	hsa-miR-548s	CLIP-seq
MIRT1476305	hsa-miR-588	CLIP-seq
MIRT1476306	hsa-miR-590-3p	CLIP-seq
MIRT1476307	hsa-miR-764	CLIP-seq
MIRT1476308	hsa-miR-93	CLIP-seq
MIRT1476248	hsa-miR-1224-3p	CLIP-seq
MIRT1476252	hsa-miR-125a-3p	CLIP-seq
MIRT1476255	hsa-miR-1913	CLIP-seq
MIRT1476256	hsa-miR-197	CLIP-seq
MIRT1476265	hsa-miR-3187-3p	CLIP-seq
MIRT1476266	hsa-miR-324-3p	CLIP-seq
MIRT1476267	hsa-miR-3545-3p	CLIP-seq
MIRT1476268	hsa-miR-3663-5p	CLIP-seq
MIRT1476273	hsa-miR-3934	CLIP-seq
MIRT1476277	hsa-miR-4435	CLIP-seq
MIRT1476279	hsa-miR-4635	CLIP-seq
MIRT1476280	hsa-miR-4680-5p	CLIP-seq
MIRT1476281	hsa-miR-4701-5p	CLIP-seq
MIRT1476282	hsa-miR-4716-5p	CLIP-seq
MIRT1476285	hsa-miR-4732-5p	CLIP-seq
MIRT1476287	hsa-miR-4755-3p	CLIP-seq
MIRT1476290	hsa-miR-4781-3p	CLIP-seq
MIRT1476292	hsa-miR-483-5p	CLIP-seq
MIRT1476294	hsa-miR-5096	CLIP-seq
MIRT1476304	hsa-miR-548s	CLIP-seq
MIRT1476305	hsa-miR-588	CLIP-seq
MIRT1476307	hsa-miR-764	CLIP-seq
MIRT2143501	hsa-miR-1305	CLIP-seq
MIRT2143502	hsa-miR-132	CLIP-seq
MIRT1476256	hsa-miR-197	CLIP-seq
MIRT2143503	hsa-miR-212	CLIP-seq
MIRT1476264	hsa-miR-3149	CLIP-seq
MIRT1476265	hsa-miR-3187-3p	CLIP-seq
MIRT1476267	hsa-miR-3545-3p	CLIP-seq
MIRT1476268	hsa-miR-3663-5p	CLIP-seq
MIRT1476270	hsa-miR-3674	CLIP-seq
MIRT2143504	hsa-miR-421	CLIP-seq
MIRT2143505	hsa-miR-4279	CLIP-seq
MIRT1476277	hsa-miR-4435	CLIP-seq
MIRT1476278	hsa-miR-4438	CLIP-seq
MIRT1476279	hsa-miR-4635	CLIP-seq
MIRT1476280	hsa-miR-4680-5p	CLIP-seq
MIRT1476281	hsa-miR-4701-5p	CLIP-seq
MIRT2143506	hsa-miR-4709-5p	CLIP-seq
MIRT1476282	hsa-miR-4716-5p	CLIP-seq
MIRT1476285	hsa-miR-4732-5p	CLIP-seq
MIRT1476286	hsa-miR-4735-5p	CLIP-seq
MIRT1476287	hsa-miR-4755-3p	CLIP-seq
MIRT1476289	hsa-miR-4775	CLIP-seq
MIRT1476290	hsa-miR-4781-3p	CLIP-seq
MIRT1476291	hsa-miR-4794	CLIP-seq
MIRT1476292	hsa-miR-483-5p	CLIP-seq
MIRT1476293	hsa-miR-5095	CLIP-seq
MIRT1476294	hsa-miR-5096	CLIP-seq
MIRT1476304	hsa-miR-548s	CLIP-seq
MIRT1476305	hsa-miR-588	CLIP-seq
MIRT1476306	hsa-miR-590-3p	CLIP-seq
MIRT1476246	hsa-miR-106a	CLIP-seq
MIRT1476247	hsa-miR-106b	CLIP-seq
MIRT1476248	hsa-miR-1224-3p	CLIP-seq
MIRT1476251	hsa-miR-1234	CLIP-seq
MIRT1476252	hsa-miR-125a-3p	CLIP-seq
MIRT1476253	hsa-miR-150	CLIP-seq
MIRT1476254	hsa-miR-17	CLIP-seq
MIRT1476255	hsa-miR-1913	CLIP-seq
MIRT1476256	hsa-miR-197	CLIP-seq
MIRT1476257	hsa-miR-20a	CLIP-seq
MIRT1476258	hsa-miR-20b	CLIP-seq
MIRT1476259	hsa-miR-302a	CLIP-seq
MIRT1476260	hsa-miR-302b	CLIP-seq
MIRT1476261	hsa-miR-302c	CLIP-seq
MIRT1476262	hsa-miR-302d	CLIP-seq
MIRT1476263	hsa-miR-302e	CLIP-seq
MIRT1476264	hsa-miR-3149	CLIP-seq
MIRT1476265	hsa-miR-3187-3p	CLIP-seq
MIRT1476266	hsa-miR-324-3p	CLIP-seq
MIRT1476268	hsa-miR-3663-5p	CLIP-seq
MIRT1476270	hsa-miR-3674	CLIP-seq
MIRT1476271	hsa-miR-372	CLIP-seq
MIRT1476272	hsa-miR-373	CLIP-seq
MIRT1476273	hsa-miR-3934	CLIP-seq
MIRT1476277	hsa-miR-4435	CLIP-seq
MIRT1476278	hsa-miR-4438	CLIP-seq
MIRT1476281	hsa-miR-4701-5p	CLIP-seq
MIRT1476282	hsa-miR-4716-5p	CLIP-seq
MIRT1476284	hsa-miR-4731-5p	CLIP-seq
MIRT1476285	hsa-miR-4732-5p	CLIP-seq
MIRT1476286	hsa-miR-4735-5p	CLIP-seq
MIRT1476287	hsa-miR-4755-3p	CLIP-seq
MIRT1476289	hsa-miR-4775	CLIP-seq
MIRT1476290	hsa-miR-4781-3p	CLIP-seq
MIRT1476291	hsa-miR-4794	CLIP-seq
MIRT1476292	hsa-miR-483-5p	CLIP-seq
MIRT1476293	hsa-miR-5095	CLIP-seq
MIRT1476294	hsa-miR-5096	CLIP-seq
MIRT1476295	hsa-miR-512-3p	CLIP-seq
MIRT1476296	hsa-miR-519d	CLIP-seq
MIRT1476297	hsa-miR-520a-3p	CLIP-seq
MIRT1476298	hsa-miR-520b	CLIP-seq
MIRT1476299	hsa-miR-520c-3p	CLIP-seq
MIRT1476300	hsa-miR-520d-3p	CLIP-seq
MIRT1476301	hsa-miR-520e	CLIP-seq
MIRT1476302	hsa-miR-520g	CLIP-seq
MIRT1476303	hsa-miR-520h	CLIP-seq
MIRT1476304	hsa-miR-548s	CLIP-seq
MIRT1476305	hsa-miR-588	CLIP-seq
MIRT1476306	hsa-miR-590-3p	CLIP-seq
MIRT1476307	hsa-miR-764	CLIP-seq
MIRT1476308	hsa-miR-93	CLIP-seq
MIRT1476278	hsa-miR-4438	CLIP-seq
MIRT1476293	hsa-miR-5095	CLIP-seq
MIRT1476264	hsa-miR-3149	CLIP-seq
MIRT1476270	hsa-miR-3674	CLIP-seq
MIRT1476283	hsa-miR-4722-3p	CLIP-seq
MIRT1476285	hsa-miR-4732-5p	CLIP-seq
MIRT1476286	hsa-miR-4735-5p	CLIP-seq
MIRT1476288	hsa-miR-4769-3p	CLIP-seq
MIRT1476289	hsa-miR-4775	CLIP-seq
MIRT1476291	hsa-miR-4794	CLIP-seq
MIRT1476292	hsa-miR-483-5p	CLIP-seq
MIRT1476306	hsa-miR-590-3p	CLIP-seq
MIRT1476246	hsa-miR-106a	CLIP-seq
MIRT1476247	hsa-miR-106b	CLIP-seq
MIRT1476248	hsa-miR-1224-3p	CLIP-seq
MIRT1476251	hsa-miR-1234	CLIP-seq
MIRT1476252	hsa-miR-125a-3p	CLIP-seq
MIRT1476253	hsa-miR-150	CLIP-seq
MIRT1476254	hsa-miR-17	CLIP-seq
MIRT1476255	hsa-miR-1913	CLIP-seq
MIRT1476257	hsa-miR-20a	CLIP-seq
MIRT1476258	hsa-miR-20b	CLIP-seq
MIRT1476259	hsa-miR-302a	CLIP-seq
MIRT1476260	hsa-miR-302b	CLIP-seq
MIRT1476261	hsa-miR-302c	CLIP-seq
MIRT1476262	hsa-miR-302d	CLIP-seq
MIRT1476263	hsa-miR-302e	CLIP-seq
MIRT1476264	hsa-miR-3149	CLIP-seq
MIRT2657412	hsa-miR-3159	CLIP-seq
MIRT1476266	hsa-miR-324-3p	CLIP-seq
MIRT1476271	hsa-miR-372	CLIP-seq
MIRT1476272	hsa-miR-373	CLIP-seq
MIRT1476273	hsa-miR-3934	CLIP-seq
MIRT2657413	hsa-miR-4293	CLIP-seq
MIRT2657414	hsa-miR-4480	CLIP-seq
MIRT1476283	hsa-miR-4722-3p	CLIP-seq
MIRT1476284	hsa-miR-4731-5p	CLIP-seq
MIRT1476286	hsa-miR-4735-5p	CLIP-seq
MIRT2657415	hsa-miR-4763-5p	CLIP-seq
MIRT1476288	hsa-miR-4769-3p	CLIP-seq
MIRT1476289	hsa-miR-4775	CLIP-seq
MIRT1476291	hsa-miR-4794	CLIP-seq
MIRT1476295	hsa-miR-512-3p	CLIP-seq
MIRT1476296	hsa-miR-519d	CLIP-seq
MIRT1476297	hsa-miR-520a-3p	CLIP-seq
MIRT1476298	hsa-miR-520b	CLIP-seq
MIRT1476299	hsa-miR-520c-3p	CLIP-seq
MIRT1476300	hsa-miR-520d-3p	CLIP-seq
MIRT1476301	hsa-miR-520e	CLIP-seq
MIRT1476302	hsa-miR-520g	CLIP-seq
MIRT1476303	hsa-miR-520h	CLIP-seq
MIRT2657416	hsa-miR-562	CLIP-seq
MIRT1476306	hsa-miR-590-3p	CLIP-seq
MIRT2657417	hsa-miR-596	CLIP-seq
MIRT1476307	hsa-miR-764	CLIP-seq
MIRT1476308	hsa-miR-93	CLIP-seq
MIRT1476264	hsa-miR-3149	CLIP-seq
MIRT1476270	hsa-miR-3674	CLIP-seq
MIRT1476283	hsa-miR-4722-3p	CLIP-seq
MIRT1476285	hsa-miR-4732-5p	CLIP-seq
MIRT1476286	hsa-miR-4735-5p	CLIP-seq
MIRT1476288	hsa-miR-4769-3p	CLIP-seq
MIRT1476289	hsa-miR-4775	CLIP-seq
MIRT1476291	hsa-miR-4794	CLIP-seq
MIRT1476306	hsa-miR-590-3p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	NAS	9935153
GO:0005515	Function	Protein binding	IPI	32296183
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9818021, 9935153
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030855	Process	Epithelial cell differentiation	IDA	10514386
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0120001	Component	Apical plasma membrane urothelial plaque	IEA

MIM	HGNC	e!Ensembl
602380	12578	ENSG00000114638

O75841

Protein name

Uroplakin-1b (UP1b) (Tetraspanin-20) (Tspan-20) (Uroplakin Ib) (UPIb)

Protein function

Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane perme

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	10 → 256	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Bladder epithelium.

Sequence

MAKDNSTVRCFQGLLIFGNVIIGCCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAW
IGIFVGICLFCLSVLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITAATQQDFFTPNL
FLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENN
DADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRHAWGVAWFGFAI
LCWTFWVLLGTMFYWSRIEY

Sequence length

260

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	27890644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30669148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30229818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	27115886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15140401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15140401, 30229818, 9935153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33275221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38114532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15140401, 16354592	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	9818021, 9846985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35550834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	23670165, 32377607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	35550834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	27115886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38114532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30229818	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	9846985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30229818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	9935153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25330770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	35550834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	35550834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22585360, 30229818, 9935153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30702489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15140401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	9935153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15140401, 30229818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37777995	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	23670165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UPK1B (uroplakin 1B)