Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7347
Gene name	Ubiquitin C-terminal hydrolase L3
Gene symbol	UCHL3
Synonyms (NCBI Gene)	UCH-L3
Chromosome	13
Chromosome location	13q22.2
Summary	The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. T

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019702	hsa-miR-375	Microarray	20215506
MIRT047087	hsa-miR-183-5p	CLASH	23622248
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT717174	hsa-miR-532-5p	HITS-CLIP	19536157
MIRT717173	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT717172	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT717171	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT717169	hsa-miR-4534	HITS-CLIP	19536157
MIRT717170	hsa-miR-8082	HITS-CLIP	19536157
MIRT717168	hsa-miR-3134	HITS-CLIP	19536157
MIRT717167	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT717166	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT717165	hsa-miR-5093	HITS-CLIP	19536157
MIRT717164	hsa-miR-4633-5p	HITS-CLIP	19536157
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT520283	hsa-miR-8485	PAR-CLIP	21572407
MIRT520282	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT520281	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT520280	hsa-miR-603	PAR-CLIP	21572407
MIRT520279	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT520278	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT520277	hsa-miR-875-5p	PAR-CLIP	21572407
MIRT520276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT520274	hsa-miR-3941	PAR-CLIP	21572407
MIRT520275	hsa-miR-3144-3p	PAR-CLIP	21572407
MIRT520273	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT528099	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT528098	hsa-miR-548p	PAR-CLIP	22012620
MIRT528097	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT528096	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT528095	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT528094	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT528093	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT528092	hsa-miR-2117	PAR-CLIP	22012620
MIRT528091	hsa-miR-513c-5p	PAR-CLIP	22012620
MIRT528090	hsa-miR-514b-5p	PAR-CLIP	22012620
MIRT528089	hsa-miR-4273	PAR-CLIP	22012620
MIRT528088	hsa-miR-7156-5p	PAR-CLIP	22012620
MIRT520283	hsa-miR-8485	PAR-CLIP	23446348
MIRT520282	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT520281	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT520280	hsa-miR-603	PAR-CLIP	23446348
MIRT520279	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT520278	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT520277	hsa-miR-875-5p	PAR-CLIP	23446348
MIRT520276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT520274	hsa-miR-3941	PAR-CLIP	23446348
MIRT520275	hsa-miR-3144-3p	PAR-CLIP	23446348
MIRT520273	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT717174	hsa-miR-532-5p	HITS-CLIP	19536157
MIRT717173	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT717172	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT717171	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT717169	hsa-miR-4534	HITS-CLIP	19536157
MIRT717170	hsa-miR-8082	HITS-CLIP	19536157
MIRT717168	hsa-miR-3134	HITS-CLIP	19536157
MIRT717167	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT717166	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT717165	hsa-miR-5093	HITS-CLIP	19536157
MIRT717164	hsa-miR-4633-5p	HITS-CLIP	19536157
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT709706	hsa-miR-606	HITS-CLIP	19536157
MIRT520283	hsa-miR-8485	PAR-CLIP	21572407
MIRT520282	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT520281	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT520280	hsa-miR-603	PAR-CLIP	21572407
MIRT520279	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT520278	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT520277	hsa-miR-875-5p	PAR-CLIP	21572407
MIRT520276	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT520274	hsa-miR-3941	PAR-CLIP	21572407
MIRT520275	hsa-miR-3144-3p	PAR-CLIP	21572407
MIRT520273	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT528099	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT528098	hsa-miR-548p	PAR-CLIP	22012620
MIRT528097	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT528096	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT528095	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT528094	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT528093	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT528092	hsa-miR-2117	PAR-CLIP	22012620
MIRT528091	hsa-miR-513c-5p	PAR-CLIP	22012620
MIRT528090	hsa-miR-514b-5p	PAR-CLIP	22012620
MIRT528089	hsa-miR-4273	PAR-CLIP	22012620
MIRT528088	hsa-miR-7156-5p	PAR-CLIP	22012620
MIRT520283	hsa-miR-8485	PAR-CLIP	23446348
MIRT520282	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT520281	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT520280	hsa-miR-603	PAR-CLIP	23446348
MIRT520279	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT520278	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT520277	hsa-miR-875-5p	PAR-CLIP	23446348
MIRT520276	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT520274	hsa-miR-3941	PAR-CLIP	23446348
MIRT520275	hsa-miR-3144-3p	PAR-CLIP	23446348
MIRT520273	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT1472393	hsa-miR-183	CLIP-seq
MIRT1472394	hsa-miR-3647-3p	CLIP-seq
MIRT1472395	hsa-miR-3919	CLIP-seq
MIRT1472396	hsa-miR-4282	CLIP-seq
MIRT1472397	hsa-miR-4684-3p	CLIP-seq
MIRT1472398	hsa-miR-518a-5p	CLIP-seq
MIRT1472399	hsa-miR-527	CLIP-seq
MIRT2142306	hsa-miR-369-3p	CLIP-seq
MIRT2142307	hsa-miR-374c	CLIP-seq
MIRT2142308	hsa-miR-4328	CLIP-seq
MIRT1472397	hsa-miR-4684-3p	CLIP-seq
MIRT1472398	hsa-miR-518a-5p	CLIP-seq
MIRT1472399	hsa-miR-527	CLIP-seq
MIRT2142309	hsa-miR-582-5p	CLIP-seq
MIRT2142310	hsa-miR-655	CLIP-seq
MIRT1472394	hsa-miR-3647-3p	CLIP-seq
MIRT1472395	hsa-miR-3919	CLIP-seq
MIRT1472396	hsa-miR-4282	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	EXP	26235645
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	9521656, 19047059
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	2530630
GO:0005515	Function	Protein binding	IPI	19615732, 21453705, 32814053, 33961781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0008233	Function	Peptidase activity	IDA	21762696
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	IDA	9521656, 19047059
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019784	Function	DeNEDDylase activity	TAS
GO:0030163	Process	Protein catabolic process	IBA
GO:0030163	Process	Protein catabolic process	IDA	21762696
GO:0030163	Process	Protein catabolic process	IEA
GO:0043130	Function	Ubiquitin binding	IDA	19154770
GO:0043687	Process	Post-translational protein modification	TAS
GO:0101005	Function	Deubiquitinase activity	IEA

MIM	HGNC	e!Ensembl
603090	12515	ENSG00000118939

P15374

Protein name

Ubiquitin carboxyl-terminal hydrolase isozyme L3 (UCH-L3) (EC 3.4.19.12) (Ubiquitin thioesterase L3)

Protein function

Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiq

PDB

1UCH , 1XD3 , 6ISU , 6QML , 7YV4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01088	Peptidase_C12	6 → 214	Ubiquitin carboxyl-terminal hydrolase, family 1	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, and testis. {ECO:0000269|PubMed:9790970}.

Sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Sequence length

230

Interactions

View interactions

	Reactome
			UCH proteinases Synthesis of active ubiquitin: roles of E1 and E2 enzymes Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	29898404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	39600279	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27941124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16734731, 27941124, 35053210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32546741, 36813921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32486284	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31477831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24503940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	GWASDB_DG	23562823		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23562823	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infertility Male	Male infertility	Pubtator	27780264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	16380264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27941124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31477831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31598398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27941124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31598398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16537382, 29898404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21762696		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31477831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31598398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16380264, 20302855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29898404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	29898404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar ataxia autosomal recessive 1	Spinocerebellar ataxia	Pubtator	29898404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE, WITH AXONAL NEUROPATHY	Spinocerebellar Ataxia, WITH AXONAL NEUROPATHY	BEFREE	29898404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37460253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	36813921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31113933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	16402389		★★★★★ ★☆☆☆☆ Found in Text Mining only

UCHL3 (ubiquitin C-terminal hydrolase L3)