SUMO1 (small ubiquitin like modifier 1)

Gene

• Entrez ID: 7341
• Gene name: Small ubiquitin like modifier 1
• Gene symbol: SUMO1
• Synonyms (NCBI Gene): DAP1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1
• Chromosome: 2
• Chromosome location: 2q33.1
• Summary: This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT036934	hsa-miR-877-3p	CLASH	23622248
MIRT679095	hsa-miR-431-3p	HITS-CLIP	23824327
MIRT679094	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT679093	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT679092	hsa-miR-7977	HITS-CLIP	23824327
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT468620	hsa-miR-4481	PAR-CLIP	20371350
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT484199	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT484195	hsa-miR-3175	PAR-CLIP	20371350
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT484191	hsa-miR-5698	PAR-CLIP	20371350
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT484199	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT484195	hsa-miR-3175	PAR-CLIP	20371350
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT484191	hsa-miR-5698	PAR-CLIP	20371350
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT484199	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT484195	hsa-miR-3175	PAR-CLIP	20371350
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT484191	hsa-miR-5698	PAR-CLIP	20371350
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT540646	hsa-miR-603	PAR-CLIP	21572407
MIRT540645	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT540644	hsa-miR-552-3p	PAR-CLIP	21572407
MIRT540643	hsa-miR-7845-5p	PAR-CLIP	21572407
MIRT540642	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT540641	hsa-miR-6868-5p	PAR-CLIP	21572407
MIRT540640	hsa-miR-1207-5p	PAR-CLIP	21572407
MIRT540639	hsa-miR-4763-3p	PAR-CLIP	21572407
MIRT540637	hsa-miR-4736	PAR-CLIP	21572407
MIRT540638	hsa-miR-4284	PAR-CLIP	21572407
MIRT540636	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT540635	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT540634	hsa-miR-7150	PAR-CLIP	21572407
MIRT540646	hsa-miR-603	PAR-CLIP	21572407
MIRT540645	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT540644	hsa-miR-552-3p	PAR-CLIP	21572407
MIRT540643	hsa-miR-7845-5p	PAR-CLIP	21572407
MIRT540642	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT534402	hsa-miR-764	PAR-CLIP	21572407
MIRT540641	hsa-miR-6868-5p	PAR-CLIP	21572407
MIRT540640	hsa-miR-1207-5p	PAR-CLIP	21572407
MIRT540639	hsa-miR-4763-3p	PAR-CLIP	21572407
MIRT540637	hsa-miR-4736	PAR-CLIP	21572407
MIRT540638	hsa-miR-4284	PAR-CLIP	21572407
MIRT540636	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT540635	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT540634	hsa-miR-7150	PAR-CLIP	21572407
MIRT534405	hsa-miR-624-5p	PAR-CLIP	22012620
MIRT534404	hsa-miR-3074-3p	PAR-CLIP	22012620
MIRT534403	hsa-miR-125a-3p	PAR-CLIP	22012620
MIRT534402	hsa-miR-764	PAR-CLIP	22012620
MIRT534401	hsa-miR-3934-5p	PAR-CLIP	22012620
MIRT534400	hsa-miR-4424	PAR-CLIP	22012620
MIRT534399	hsa-miR-8068	PAR-CLIP	22012620
MIRT534398	hsa-miR-5585-3p	PAR-CLIP	22012620
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	23446348
MIRT484226	hsa-miR-1321	PAR-CLIP	23446348
MIRT484225	hsa-miR-4739	PAR-CLIP	23446348
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	23446348
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	23446348
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	23446348
MIRT484221	hsa-miR-4419a	PAR-CLIP	23446348
MIRT484220	hsa-miR-4510	PAR-CLIP	23446348
MIRT484219	hsa-miR-6127	PAR-CLIP	23446348
MIRT484218	hsa-miR-6129	PAR-CLIP	23446348
MIRT484217	hsa-miR-6130	PAR-CLIP	23446348
MIRT484216	hsa-miR-6133	PAR-CLIP	23446348
MIRT468620	hsa-miR-4481	PAR-CLIP	23446348
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	23446348
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT484212	hsa-miR-8085	PAR-CLIP	23446348
MIRT501213	hsa-let-7b-5p	PAR-CLIP	24398324
MIRT501211	hsa-let-7f-5p	PAR-CLIP	24398324
MIRT501210	hsa-let-7c-5p	PAR-CLIP	24398324
MIRT501209	hsa-let-7d-5p	PAR-CLIP	24398324
MIRT501208	hsa-let-7g-5p	PAR-CLIP	24398324
MIRT501207	hsa-miR-4458	PAR-CLIP	24398324
MIRT501206	hsa-miR-4500	PAR-CLIP	24398324
MIRT501205	hsa-let-7a-5p	PAR-CLIP	24398324
MIRT501204	hsa-let-7i-5p	PAR-CLIP	24398324
MIRT501203	hsa-miR-98-5p	PAR-CLIP	24398324
MIRT501202	hsa-let-7e-5p	PAR-CLIP	24398324
MIRT501201	hsa-miR-5700	PAR-CLIP	24398324
MIRT501199	hsa-miR-8076	PAR-CLIP	24398324
MIRT501200	hsa-miR-3688-3p	PAR-CLIP	24398324
MIRT501198	hsa-miR-654-3p	PAR-CLIP	24398324
MIRT501197	hsa-miR-4677-3p	PAR-CLIP	24398324
MIRT501196	hsa-miR-4679	PAR-CLIP	24398324
MIRT501195	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501194	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT501193	hsa-miR-6076	PAR-CLIP	24398324
MIRT501192	hsa-miR-6797-3p	PAR-CLIP	24398324
MIRT501191	hsa-miR-5093	PAR-CLIP	24398324
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT484226	hsa-miR-1321	PAR-CLIP	23592263
MIRT484225	hsa-miR-4739	PAR-CLIP	23592263
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484221	hsa-miR-4419a	PAR-CLIP	23592263
MIRT484220	hsa-miR-4510	PAR-CLIP	23592263
MIRT484219	hsa-miR-6127	PAR-CLIP	23592263
MIRT484218	hsa-miR-6129	PAR-CLIP	23592263
MIRT484217	hsa-miR-6130	PAR-CLIP	23592263
MIRT484216	hsa-miR-6133	PAR-CLIP	23592263
MIRT468620	hsa-miR-4481	PAR-CLIP	23592263
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT484212	hsa-miR-8085	PAR-CLIP	23592263
MIRT484211	hsa-miR-3154	PAR-CLIP	23592263
MIRT484210	hsa-miR-5681a	PAR-CLIP	23592263
MIRT484209	hsa-miR-3179	PAR-CLIP	23592263
MIRT484208	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT484207	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT484206	hsa-miR-4434	PAR-CLIP	23592263
MIRT484205	hsa-miR-4516	PAR-CLIP	23592263
MIRT484204	hsa-miR-5703	PAR-CLIP	23592263
MIRT484203	hsa-miR-3153	PAR-CLIP	23592263
MIRT484202	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT484200	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT484201	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT484199	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT484195	hsa-miR-3175	PAR-CLIP	23592263
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484193	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT484191	hsa-miR-5698	PAR-CLIP	23592263
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT484188	hsa-miR-4525	PAR-CLIP	23592263
MIRT484186	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT484187	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT484185	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT484184	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT484183	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT484182	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT484181	hsa-miR-4447	PAR-CLIP	23592263
MIRT484180	hsa-miR-4472	PAR-CLIP	23592263
MIRT484179	hsa-miR-1275	PAR-CLIP	23592263
MIRT484178	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT484177	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT300131	hsa-miR-3606-3p	PAR-CLIP	23592263
MIRT300128	hsa-miR-513a-3p	PAR-CLIP	23592263
MIRT300130	hsa-miR-513c-3p	PAR-CLIP	23592263
MIRT468625	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT468624	hsa-miR-6514-5p	PAR-CLIP	23592263
MIRT468623	hsa-miR-205-3p	PAR-CLIP	23592263
MIRT468622	hsa-miR-5693	PAR-CLIP	23592263
MIRT468621	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT468620	hsa-miR-4481	PAR-CLIP	23592263
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT468618	hsa-miR-4534	PAR-CLIP	23592263
MIRT468617	hsa-miR-8082	PAR-CLIP	23592263
MIRT468616	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT468615	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT468614	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT468613	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT468612	hsa-miR-4450	PAR-CLIP	23592263
MIRT468611	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT468610	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT468609	hsa-miR-4276	PAR-CLIP	23592263
MIRT468608	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT468607	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT468606	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT468605	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT468604	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT468603	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT679095	hsa-miR-431-3p	HITS-CLIP	23824327
MIRT679094	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT679093	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT679092	hsa-miR-7977	HITS-CLIP	23824327
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT468620	hsa-miR-4481	PAR-CLIP	20371350
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT484199	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT484195	hsa-miR-3175	PAR-CLIP	20371350
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT484191	hsa-miR-5698	PAR-CLIP	20371350
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT484199	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT484195	hsa-miR-3175	PAR-CLIP	20371350
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT484191	hsa-miR-5698	PAR-CLIP	20371350
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT484199	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT484195	hsa-miR-3175	PAR-CLIP	20371350
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT484191	hsa-miR-5698	PAR-CLIP	20371350
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	20371350
MIRT484226	hsa-miR-1321	PAR-CLIP	20371350
MIRT484225	hsa-miR-4739	PAR-CLIP	20371350
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484221	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484220	hsa-miR-4510	PAR-CLIP	20371350
MIRT484219	hsa-miR-6127	PAR-CLIP	20371350
MIRT484218	hsa-miR-6129	PAR-CLIP	20371350
MIRT484217	hsa-miR-6130	PAR-CLIP	20371350
MIRT484216	hsa-miR-6133	PAR-CLIP	20371350
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT484212	hsa-miR-8085	PAR-CLIP	20371350
MIRT540646	hsa-miR-603	PAR-CLIP	21572407
MIRT540645	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT540644	hsa-miR-552-3p	PAR-CLIP	21572407
MIRT540643	hsa-miR-7845-5p	PAR-CLIP	21572407
MIRT540642	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT540641	hsa-miR-6868-5p	PAR-CLIP	21572407
MIRT540640	hsa-miR-1207-5p	PAR-CLIP	21572407
MIRT540639	hsa-miR-4763-3p	PAR-CLIP	21572407
MIRT540637	hsa-miR-4736	PAR-CLIP	21572407
MIRT540638	hsa-miR-4284	PAR-CLIP	21572407
MIRT540636	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT540635	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT540634	hsa-miR-7150	PAR-CLIP	21572407
MIRT540646	hsa-miR-603	PAR-CLIP	21572407
MIRT540645	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT540644	hsa-miR-552-3p	PAR-CLIP	21572407
MIRT540643	hsa-miR-7845-5p	PAR-CLIP	21572407
MIRT540642	hsa-miR-211-3p	PAR-CLIP	21572407
MIRT534402	hsa-miR-764	PAR-CLIP	21572407
MIRT540641	hsa-miR-6868-5p	PAR-CLIP	21572407
MIRT540640	hsa-miR-1207-5p	PAR-CLIP	21572407
MIRT540639	hsa-miR-4763-3p	PAR-CLIP	21572407
MIRT540637	hsa-miR-4736	PAR-CLIP	21572407
MIRT540638	hsa-miR-4284	PAR-CLIP	21572407
MIRT540636	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT540635	hsa-miR-106a-3p	PAR-CLIP	21572407
MIRT540634	hsa-miR-7150	PAR-CLIP	21572407
MIRT534405	hsa-miR-624-5p	PAR-CLIP	22012620
MIRT534404	hsa-miR-3074-3p	PAR-CLIP	22012620
MIRT534403	hsa-miR-125a-3p	PAR-CLIP	22012620
MIRT534402	hsa-miR-764	PAR-CLIP	22012620
MIRT534401	hsa-miR-3934-5p	PAR-CLIP	22012620
MIRT534400	hsa-miR-4424	PAR-CLIP	22012620
MIRT534399	hsa-miR-8068	PAR-CLIP	22012620
MIRT534398	hsa-miR-5585-3p	PAR-CLIP	22012620
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	23446348
MIRT484226	hsa-miR-1321	PAR-CLIP	23446348
MIRT484225	hsa-miR-4739	PAR-CLIP	23446348
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	23446348
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	23446348
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	23446348
MIRT484221	hsa-miR-4419a	PAR-CLIP	23446348
MIRT484220	hsa-miR-4510	PAR-CLIP	23446348
MIRT484219	hsa-miR-6127	PAR-CLIP	23446348
MIRT484218	hsa-miR-6129	PAR-CLIP	23446348
MIRT484217	hsa-miR-6130	PAR-CLIP	23446348
MIRT484216	hsa-miR-6133	PAR-CLIP	23446348
MIRT468620	hsa-miR-4481	PAR-CLIP	23446348
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	23446348
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT484212	hsa-miR-8085	PAR-CLIP	23446348
MIRT501213	hsa-let-7b-5p	PAR-CLIP	24398324
MIRT501211	hsa-let-7f-5p	PAR-CLIP	24398324
MIRT501210	hsa-let-7c-5p	PAR-CLIP	24398324
MIRT501209	hsa-let-7d-5p	PAR-CLIP	24398324
MIRT501208	hsa-let-7g-5p	PAR-CLIP	24398324
MIRT501207	hsa-miR-4458	PAR-CLIP	24398324
MIRT501206	hsa-miR-4500	PAR-CLIP	24398324
MIRT501205	hsa-let-7a-5p	PAR-CLIP	24398324
MIRT501204	hsa-let-7i-5p	PAR-CLIP	24398324
MIRT501203	hsa-miR-98-5p	PAR-CLIP	24398324
MIRT501202	hsa-let-7e-5p	PAR-CLIP	24398324
MIRT501201	hsa-miR-5700	PAR-CLIP	24398324
MIRT501199	hsa-miR-8076	PAR-CLIP	24398324
MIRT501200	hsa-miR-3688-3p	PAR-CLIP	24398324
MIRT501198	hsa-miR-654-3p	PAR-CLIP	24398324
MIRT501197	hsa-miR-4677-3p	PAR-CLIP	24398324
MIRT501196	hsa-miR-4679	PAR-CLIP	24398324
MIRT501195	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501194	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT501193	hsa-miR-6076	PAR-CLIP	24398324
MIRT501192	hsa-miR-6797-3p	PAR-CLIP	24398324
MIRT501191	hsa-miR-5093	PAR-CLIP	24398324
MIRT484227	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT484226	hsa-miR-1321	PAR-CLIP	23592263
MIRT484225	hsa-miR-4739	PAR-CLIP	23592263
MIRT484224	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT484223	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484222	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484221	hsa-miR-4419a	PAR-CLIP	23592263
MIRT484220	hsa-miR-4510	PAR-CLIP	23592263
MIRT484219	hsa-miR-6127	PAR-CLIP	23592263
MIRT484218	hsa-miR-6129	PAR-CLIP	23592263
MIRT484217	hsa-miR-6130	PAR-CLIP	23592263
MIRT484216	hsa-miR-6133	PAR-CLIP	23592263
MIRT468620	hsa-miR-4481	PAR-CLIP	23592263
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT484215	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT484213	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT484214	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT484212	hsa-miR-8085	PAR-CLIP	23592263
MIRT484211	hsa-miR-3154	PAR-CLIP	23592263
MIRT484210	hsa-miR-5681a	PAR-CLIP	23592263
MIRT484209	hsa-miR-3179	PAR-CLIP	23592263
MIRT484208	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT484207	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT484206	hsa-miR-4434	PAR-CLIP	23592263
MIRT484205	hsa-miR-4516	PAR-CLIP	23592263
MIRT484204	hsa-miR-5703	PAR-CLIP	23592263
MIRT484203	hsa-miR-3153	PAR-CLIP	23592263
MIRT484202	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT484200	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT484201	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT484199	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT484198	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT484197	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT484196	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT484195	hsa-miR-3175	PAR-CLIP	23592263
MIRT484194	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484193	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT484192	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT484191	hsa-miR-5698	PAR-CLIP	23592263
MIRT484190	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT484189	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT484188	hsa-miR-4525	PAR-CLIP	23592263
MIRT484186	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT484187	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT484185	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT484184	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT484183	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT484182	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT484181	hsa-miR-4447	PAR-CLIP	23592263
MIRT484180	hsa-miR-4472	PAR-CLIP	23592263
MIRT484179	hsa-miR-1275	PAR-CLIP	23592263
MIRT484178	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT484177	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT300131	hsa-miR-3606-3p	PAR-CLIP	23592263
MIRT300128	hsa-miR-513a-3p	PAR-CLIP	23592263
MIRT300130	hsa-miR-513c-3p	PAR-CLIP	23592263
MIRT468625	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT468624	hsa-miR-6514-5p	PAR-CLIP	23592263
MIRT468623	hsa-miR-205-3p	PAR-CLIP	23592263
MIRT468622	hsa-miR-5693	PAR-CLIP	23592263
MIRT468621	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT468620	hsa-miR-4481	PAR-CLIP	23592263
MIRT468619	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT468618	hsa-miR-4534	PAR-CLIP	23592263
MIRT468617	hsa-miR-8082	PAR-CLIP	23592263
MIRT468616	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT468615	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT468614	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT468613	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT468612	hsa-miR-4450	PAR-CLIP	23592263
MIRT468611	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT468610	hsa-miR-4474-5p	PAR-CLIP	23592263
MIRT468609	hsa-miR-4276	PAR-CLIP	23592263
MIRT468608	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT468607	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT468606	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT468605	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT468604	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT468603	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT1403094	hsa-miR-127-5p	CLIP-seq
MIRT1403095	hsa-miR-320e	CLIP-seq
MIRT1403096	hsa-miR-1273f	CLIP-seq
MIRT1403097	hsa-miR-128	CLIP-seq
MIRT1403098	hsa-miR-197	CLIP-seq
MIRT1403099	hsa-miR-2467-5p	CLIP-seq
MIRT1403100	hsa-miR-27a	CLIP-seq
MIRT1403101	hsa-miR-27b	CLIP-seq
MIRT1403102	hsa-miR-3065-3p	CLIP-seq
MIRT1403103	hsa-miR-3127-5p	CLIP-seq
MIRT1403104	hsa-miR-3140-5p	CLIP-seq
MIRT1403105	hsa-miR-3146	CLIP-seq
MIRT1403106	hsa-miR-3183	CLIP-seq
MIRT1403107	hsa-miR-3188	CLIP-seq
MIRT1403108	hsa-miR-3199	CLIP-seq
MIRT1403109	hsa-miR-342-5p	CLIP-seq
MIRT1403110	hsa-miR-34b	CLIP-seq
MIRT1403111	hsa-miR-3647-3p	CLIP-seq
MIRT1403112	hsa-miR-3663-3p	CLIP-seq
MIRT1403113	hsa-miR-3671	CLIP-seq
MIRT1403114	hsa-miR-3918	CLIP-seq
MIRT1403115	hsa-miR-3975	CLIP-seq
MIRT1403116	hsa-miR-3978	CLIP-seq
MIRT1403117	hsa-miR-4293	CLIP-seq
MIRT1403118	hsa-miR-4311	CLIP-seq
MIRT1403119	hsa-miR-4428	CLIP-seq
MIRT1403120	hsa-miR-4433	CLIP-seq
MIRT1403121	hsa-miR-4517	CLIP-seq
MIRT1403122	hsa-miR-455-3p	CLIP-seq
MIRT1403123	hsa-miR-4649-3p	CLIP-seq
MIRT1403124	hsa-miR-4651	CLIP-seq
MIRT1403125	hsa-miR-4652-5p	CLIP-seq
MIRT1403126	hsa-miR-4664-5p	CLIP-seq
MIRT1403127	hsa-miR-4717-3p	CLIP-seq
MIRT1403128	hsa-miR-4723-3p	CLIP-seq
MIRT1403129	hsa-miR-4740-5p	CLIP-seq
MIRT1403130	hsa-miR-4773	CLIP-seq
MIRT1403131	hsa-miR-4775	CLIP-seq
MIRT1403132	hsa-miR-485-5p	CLIP-seq
MIRT1403133	hsa-miR-495	CLIP-seq
MIRT1403134	hsa-miR-548c-3p	CLIP-seq
MIRT1403135	hsa-miR-548n	CLIP-seq
MIRT1403136	hsa-miR-548t	CLIP-seq
MIRT1403137	hsa-miR-562	CLIP-seq
MIRT1403138	hsa-miR-570	CLIP-seq
MIRT1403139	hsa-miR-590-3p	CLIP-seq
MIRT1403140	hsa-miR-607	CLIP-seq
MIRT1403141	hsa-miR-608	CLIP-seq
MIRT1403142	hsa-miR-665	CLIP-seq
MIRT1403143	hsa-miR-141	CLIP-seq
MIRT1403144	hsa-miR-1468	CLIP-seq
MIRT1403145	hsa-miR-200a	CLIP-seq
MIRT1403146	hsa-miR-2052	CLIP-seq
MIRT1403147	hsa-miR-323-3p	CLIP-seq
MIRT1403148	hsa-miR-3591-3p	CLIP-seq
MIRT1403135	hsa-miR-548n	CLIP-seq
MIRT1403136	hsa-miR-548t	CLIP-seq
MIRT1403137	hsa-miR-562	CLIP-seq
MIRT1403139	hsa-miR-590-3p	CLIP-seq
MIRT2120823	hsa-miR-3182	CLIP-seq
MIRT2120824	hsa-miR-3192	CLIP-seq
MIRT2120825	hsa-miR-3660	CLIP-seq
MIRT2120826	hsa-miR-4256	CLIP-seq
MIRT2120827	hsa-miR-4314	CLIP-seq
MIRT2120828	hsa-miR-450b-3p	CLIP-seq
MIRT2120829	hsa-miR-4526	CLIP-seq
MIRT2120830	hsa-miR-4646-5p	CLIP-seq
MIRT2120831	hsa-miR-4713-3p	CLIP-seq
MIRT2120832	hsa-miR-638	CLIP-seq
MIRT2120833	hsa-miR-769-3p	CLIP-seq
MIRT2342866	hsa-miR-133a	CLIP-seq
MIRT2342867	hsa-miR-133b	CLIP-seq
MIRT2342868	hsa-miR-198	CLIP-seq
MIRT2342869	hsa-miR-3145-3p	CLIP-seq
MIRT2342870	hsa-miR-4778-3p	CLIP-seq
MIRT1403139	hsa-miR-590-3p	CLIP-seq
MIRT1403104	hsa-miR-3140-5p	CLIP-seq
MIRT1403106	hsa-miR-3183	CLIP-seq
MIRT1403128	hsa-miR-4723-3p	CLIP-seq
MIRT2636684	hsa-miR-1229	CLIP-seq
MIRT2636685	hsa-miR-1267	CLIP-seq
MIRT2636686	hsa-miR-1273d	CLIP-seq
MIRT2636687	hsa-miR-1276	CLIP-seq
MIRT2342866	hsa-miR-133a	CLIP-seq
MIRT2342867	hsa-miR-133b	CLIP-seq
MIRT2636688	hsa-miR-1915	CLIP-seq
MIRT2636689	hsa-miR-1972	CLIP-seq
MIRT2342868	hsa-miR-198	CLIP-seq
MIRT2636690	hsa-miR-2278	CLIP-seq
MIRT2636691	hsa-miR-302f	CLIP-seq
MIRT2342869	hsa-miR-3145-3p	CLIP-seq
MIRT2636692	hsa-miR-3163	CLIP-seq
MIRT2120824	hsa-miR-3192	CLIP-seq
MIRT2636693	hsa-miR-3198	CLIP-seq
MIRT2636694	hsa-miR-3613-3p	CLIP-seq
MIRT2636695	hsa-miR-3613-5p	CLIP-seq
MIRT1403111	hsa-miR-3647-3p	CLIP-seq
MIRT2636696	hsa-miR-3662	CLIP-seq
MIRT2636697	hsa-miR-3926	CLIP-seq
MIRT2636698	hsa-miR-4255	CLIP-seq
MIRT2636699	hsa-miR-4309	CLIP-seq
MIRT2120827	hsa-miR-4314	CLIP-seq
MIRT2636700	hsa-miR-4477a	CLIP-seq
MIRT2120828	hsa-miR-450b-3p	CLIP-seq
MIRT2636701	hsa-miR-4519	CLIP-seq
MIRT2636702	hsa-miR-4639-5p	CLIP-seq
MIRT2120830	hsa-miR-4646-5p	CLIP-seq
MIRT2636703	hsa-miR-4652-3p	CLIP-seq
MIRT2636704	hsa-miR-4653-3p	CLIP-seq
MIRT2636705	hsa-miR-4659a-3p	CLIP-seq
MIRT2636706	hsa-miR-4659b-3p	CLIP-seq
MIRT2636707	hsa-miR-4668-3p	CLIP-seq
MIRT2120831	hsa-miR-4713-3p	CLIP-seq
MIRT2636708	hsa-miR-4714-3p	CLIP-seq
MIRT2636709	hsa-miR-4726-3p	CLIP-seq
MIRT2636710	hsa-miR-4733-5p	CLIP-seq
MIRT2342870	hsa-miR-4778-3p	CLIP-seq
MIRT2636711	hsa-miR-4786-3p	CLIP-seq
MIRT2636712	hsa-miR-532-5p	CLIP-seq
MIRT2636713	hsa-miR-544	CLIP-seq
MIRT2636714	hsa-miR-548aa	CLIP-seq
MIRT1403134	hsa-miR-548c-3p	CLIP-seq
MIRT2636715	hsa-miR-548k	CLIP-seq
MIRT1403135	hsa-miR-548n	CLIP-seq
MIRT2636716	hsa-miR-579	CLIP-seq
MIRT2636717	hsa-miR-617	CLIP-seq
MIRT2636718	hsa-miR-630	CLIP-seq
MIRT2120832	hsa-miR-638	CLIP-seq
MIRT2636719	hsa-miR-664	CLIP-seq
MIRT2120833	hsa-miR-769-3p	CLIP-seq
MIRT2636720	hsa-miR-9	CLIP-seq
MIRT2636684	hsa-miR-1229	CLIP-seq
MIRT2636685	hsa-miR-1267	CLIP-seq
MIRT2636686	hsa-miR-1273d	CLIP-seq
MIRT2636687	hsa-miR-1276	CLIP-seq
MIRT2636688	hsa-miR-1915	CLIP-seq
MIRT2636689	hsa-miR-1972	CLIP-seq
MIRT2636690	hsa-miR-2278	CLIP-seq
MIRT2636691	hsa-miR-302f	CLIP-seq
MIRT2342869	hsa-miR-3145-3p	CLIP-seq
MIRT2636692	hsa-miR-3163	CLIP-seq
MIRT2636693	hsa-miR-3198	CLIP-seq
MIRT2636694	hsa-miR-3613-3p	CLIP-seq
MIRT2636695	hsa-miR-3613-5p	CLIP-seq
MIRT1403111	hsa-miR-3647-3p	CLIP-seq
MIRT2636696	hsa-miR-3662	CLIP-seq
MIRT2636697	hsa-miR-3926	CLIP-seq
MIRT2636698	hsa-miR-4255	CLIP-seq
MIRT2636699	hsa-miR-4309	CLIP-seq
MIRT2636700	hsa-miR-4477a	CLIP-seq
MIRT2636701	hsa-miR-4519	CLIP-seq
MIRT2636702	hsa-miR-4639-5p	CLIP-seq
MIRT2636703	hsa-miR-4652-3p	CLIP-seq
MIRT2636704	hsa-miR-4653-3p	CLIP-seq
MIRT2636705	hsa-miR-4659a-3p	CLIP-seq
MIRT2636706	hsa-miR-4659b-3p	CLIP-seq
MIRT2636707	hsa-miR-4668-3p	CLIP-seq
MIRT2636708	hsa-miR-4714-3p	CLIP-seq
MIRT2636709	hsa-miR-4726-3p	CLIP-seq
MIRT2636710	hsa-miR-4733-5p	CLIP-seq
MIRT2636711	hsa-miR-4786-3p	CLIP-seq
MIRT2636712	hsa-miR-532-5p	CLIP-seq
MIRT2636713	hsa-miR-544	CLIP-seq
MIRT2636714	hsa-miR-548aa	CLIP-seq
MIRT1403134	hsa-miR-548c-3p	CLIP-seq
MIRT2636715	hsa-miR-548k	CLIP-seq
MIRT1403135	hsa-miR-548n	CLIP-seq
MIRT2636716	hsa-miR-579	CLIP-seq
MIRT2636717	hsa-miR-617	CLIP-seq
MIRT2636718	hsa-miR-630	CLIP-seq
MIRT2636719	hsa-miR-664	CLIP-seq
MIRT2636720	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Repression	22723377
GATA4	Unknown	15337742
STAT5A	Repression	22723377
YBX1	Repression	20596676

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17264123
GO:0001741	Component	XY body	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	11112409, 11735126, 11948183, 12072434, 14516784, 15296745, 15507434, 15959518, 15983381, 16154161, 16189514, 16204249, 16494873, 16732283, 16763556, 17000644, 17036045, 17081985, 17099698, 17099700, 17491593, 17535915, 17942705, 17956732, 18264111, 18408014, 18617892, 18820298, 196
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9412458, 17081985, 24651376
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8806687
GO:0005643	Component	Nuclear pore	TAS	9019411
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	19223394
GO:0005886	Component	Plasma membrane	IEA
GO:0006281	Process	DNA repair	TAS	8812453
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	19223394
GO:0008134	Function	Transcription factor binding	ISS
GO:0015459	Function	Potassium channel regulator activity	IDA	19223394
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA	24651376
GO:0016604	Component	Nuclear body	IEA
GO:0016605	Component	PML body	IBA
GO:0016605	Component	PML body	IDA	9412458
GO:0016605	Component	PML body	IDA	9885291, 22406621, 27068747
GO:0016605	Component	PML body	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	9885291, 11889051, 14752048, 15572661, 15637059, 15959518, 17264123, 17696781, 18538659, 19223394, 21965678, 24651376, 25210186, 27068747
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	IMP	17081986
GO:0019899	Function	Enzyme binding	IPI	15959518
GO:0030578	Process	PML body organization	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	18579533
GO:0031386	Function	Protein tag activity	IBA
GO:0031386	Function	Protein tag activity	IDA	23169818
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	18408734
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	ISS
GO:0031965	Component	Nuclear membrane	IDA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	18408734
GO:0032880	Process	Regulation of protein localization	TAS	15637059
GO:0034605	Process	Cellular response to heat	IDA	11514557
GO:0042308	Process	Negative regulation of protein import into nucleus	IDA	17264123
GO:0043392	Process	Negative regulation of DNA binding	IDA	16626738
GO:0043392	Process	Negative regulation of DNA binding	IMP	15637059
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	12072434
GO:0044388	Function	Small protein activating enzyme binding	IPI	15660128
GO:0044389	Function	Ubiquitin-like protein ligase binding	IBA
GO:0045759	Process	Negative regulation of action potential	IDA	19223394
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15572661
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	12072434
GO:0050821	Process	Protein stabilization	IDA	21968017
GO:0060021	Process	Roof of mouth development	IEA
GO:0060021	Process	Roof of mouth development	ISS
GO:0071276	Process	Cellular response to cadmium ion	IDA	11514557
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	ISS
GO:0090204	Process	Protein localization to nuclear pore	IEA
GO:0097165	Component	Nuclear stress granule	IDA	11514557
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099523	Component	Presynaptic cytosol	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:0141109	Function	Transporter activator activity	IEA
GO:0141109	Function	Transporter activator activity	ISS
GO:1901017	Process	Negative regulation of potassium ion transmembrane transporter activity	IDA	23169818
GO:1902260	Process	Negative regulation of delayed rectifier potassium channel activity	IDA	19223394
GO:1903169	Process	Regulation of calcium ion transmembrane transport	IEA
GO:1903169	Process	Regulation of calcium ion transmembrane transport	ISS
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	18538659

Other IDs

• MIM: 601912
• HGNC: 12502
• e!Ensembl: ENSG00000116030

Protein

• UniProt ID: P63165
• Protein name: Small ubiquitin-related modifier 1 (SUMO-1) (GAP-modifying protein 1) (GMP1) (SMT3 homolog 3) (Sentrin) (Ubiquitin-homology domain protein PIC1) (Ubiquitin-like protein SMT3C) (Smt3C) (Ubiquitin-like protein UBL1)
• Protein function: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2
• PDB: 1A5R, 1TGZ, 1WYW, 1Y8R, 1Z5S, 2ASQ, 2BF8, 2G4D, 2IO2, 2IY0, 2IY1, 2KQS, 2LAS, 2MW5, 2N1A, 2N1V, 2PE6, 2UYZ, 2VRR, 3KYC, 3KYD, 3RZW, 3UIP, 4WJN, 4WJO, 4WJP, 4WJQ, 5AEK, 5B7A, 5ELJ, 5GHD, 6EOP, 6EOT, 6J4I, 6JXU, 6JXV, 6K5T, 6TRW, 6UYO, 6UYP, 6UYQ, 6UYR, 6UYS, 6UYT, 6UYU, 6UYV, 6UYX, 6UYY, 6UYZ, 6V7P, 6V7Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11976	Rad60-SLD	22 → 92	Ubiquitin-2 like Rad60 SUMO-like	Family

• Sequence:

  MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
  SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

• Sequence length: 101

Pathways

KEGG:

Nucleocytoplasmic transport
Fluid shear stress and atherosclerosis

Reactome:

SUMO is conjugated to E1 (UBA2:SAE1)
SUMO is transferred from E1 to E2 (UBE2I, UBC9)
SUMO is proteolytically processed
SUMOylation of DNA damage response and repair proteins
SUMO E3 ligases SUMOylate target proteins
SUMOylation of transcription factors
SUMOylation of ubiquitinylation proteins
SUMOylation of transcription cofactors
SUMOylation of SUMOylation proteins
SUMOylation of intracellular receptors
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
SUMOylation of DNA replication proteins
SUMOylation of DNA methylation proteins
SUMOylation of immune response proteins
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Nonhomologous End-Joining (NHEJ)
Processing of DNA double-strand break ends
Formation of Incision Complex in GG-NER
G2/M DNA damage checkpoint
Regulation of IFNG signaling
Negative regulation of activity of TFAP2 (AP-2) family transcription factors
Postmitotic nuclear pore complex (NPC) reformation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CLEFT LIP	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft Lip +/- Cleft Palate, Autosomal Dominant	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial cleft 10	Uncertain significance; Likely benign	ClinVar CTD, ClinVar, Disgenet, GWAS catalog, HPO CTD, ClinVar, Disgenet, GWAS catalog, HPO CTD, ClinVar, Disgenet, GWAS catalog, HPO CTD, ClinVar, Disgenet, GWAS catalog, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10373566, 15470359, 17823119, 20861261, 22584572, 23770046, 8806687, 9389704		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30393970, 31489957		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18675254, 27084229	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17823119, 24971881, 28342750		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24971881	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30703554		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24654937		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29969578		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17360386, 19565496	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29969578		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	21563299		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23078246		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23078246	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18179684, 22798505, 25530065		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17079232	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	29115559		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	10187798	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37730133	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29713182, 30393970		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27741516	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30393970, 31489957	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	23546875		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	19137569	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	18983974, 20738159, 21044801, 22492558		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	GENOMICS_ENGLAND_DG	22492558		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	31262291	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	29217476		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23640307		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37191369	Associate	★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	22155005		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21900893, 30355233		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27741516		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22155005		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	12488827		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32033996	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34663464	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15220215		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29138839		★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	28197921		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26222483, 27230680		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26222483, 27230680, 34918563	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	18675254		★☆☆☆☆ Found in Text Mining only
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	23243001		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	16401619		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23078246, 24953629		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23078246, 32592588	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23078246, 24953629		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15882793		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32592588, 38167292	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21900893, 30355233		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17823119		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	29845587		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30703554		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29217476		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	26403314		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	23350884		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	28615201		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15923626		★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10187798, 14527952, 16253240, 23770046, 9389704	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25448401, 9389704		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20502916, 30277836, 31546024		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20502916		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32033996	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30659232		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18179684, 22798505, 25530065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26222483, 27230680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29393359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29713182, 30393970		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25027693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28222440		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29393359, 30333879, 30393970, 31578236		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23640307		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23020131	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26254420	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26254420	Associate	★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25485683	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17027752		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29524504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	29868881		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19859084, 20300531, 22713753, 23640307, 29020972, 7949134		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11020216		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	16464864		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29969578		★☆☆☆☆ Found in Text Mining only
Neuronal intranuclear inclusion disease	Neuronal Intranuclear Inclusion Disease	BEFREE	14637113, 31304825		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19859084, 30043429, 30393970, 31489957		★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	19937600, 27527345	Associate	★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 10	Orofacial Cleft	GENOMICS_ENGLAND_DG	22492558		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OROFACIAL CLEFT 10	Orofacial Cleft	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OROFACIAL CLEFT 5	Orofacial Cleft	GENOMICS_ENGLAND_DG	16990542		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10187798, 34232706	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17976381		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30226577		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16443219		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	15470359		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25027693		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17932034		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26202067	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30703554		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10728754, 17360386, 19565496, 23417988, 30562482, 30681271		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17360386		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26254420	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12950712		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	26636516	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	26636516		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	19843541		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17671677		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23350884		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26152289, 38186303	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31489957		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	26400283		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28222440		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28222440, 29060933	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22904261		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36227136	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	21563299		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	30066925		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	30066925		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25485683	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	10806190		★☆☆☆☆ Found in Text Mining only