Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7324
Gene name	Ubiquitin conjugating enzyme E2 E1
Gene symbol	UBE2E1
Synonyms (NCBI Gene)	UBCH6
Chromosome	3
Chromosome location	3p24.2
Summary	The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029169	hsa-miR-26b-5p	Microarray	19088304
MIRT091614	hsa-miR-5692a	PAR-CLIP	21572407
MIRT091615	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT091614	hsa-miR-5692a	PAR-CLIP	21572407
MIRT091615	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT1467391	hsa-miR-3126-5p	CLIP-seq
MIRT1467392	hsa-miR-3668	CLIP-seq
MIRT1467393	hsa-miR-4427	CLIP-seq
MIRT1467394	hsa-miR-4432	CLIP-seq
MIRT1467395	hsa-miR-4499	CLIP-seq
MIRT1467396	hsa-miR-4720-3p	CLIP-seq
MIRT1467397	hsa-miR-499-5p	CLIP-seq
MIRT1467398	hsa-miR-548l	CLIP-seq
MIRT1467399	hsa-miR-548n	CLIP-seq
MIRT1467400	hsa-miR-582-5p	CLIP-seq
MIRT1467401	hsa-miR-600	CLIP-seq
MIRT1467402	hsa-miR-877	CLIP-seq
MIRT1467403	hsa-miR-889	CLIP-seq
MIRT1467404	hsa-miR-1236	CLIP-seq
MIRT1467405	hsa-miR-219-2-3p	CLIP-seq
MIRT1467391	hsa-miR-3126-5p	CLIP-seq
MIRT1467406	hsa-miR-3182	CLIP-seq
MIRT1467407	hsa-miR-3187-3p	CLIP-seq
MIRT1467408	hsa-miR-320e	CLIP-seq
MIRT1467409	hsa-miR-3611	CLIP-seq
MIRT1467392	hsa-miR-3668	CLIP-seq
MIRT1467410	hsa-miR-4504	CLIP-seq
MIRT1467411	hsa-miR-4529-5p	CLIP-seq
MIRT1467412	hsa-miR-4660	CLIP-seq
MIRT1467413	hsa-miR-4677-3p	CLIP-seq
MIRT1467414	hsa-miR-4679	CLIP-seq
MIRT1467415	hsa-miR-4694-3p	CLIP-seq
MIRT1467416	hsa-miR-4698	CLIP-seq
MIRT1467417	hsa-miR-486-5p	CLIP-seq
MIRT1467418	hsa-miR-490-3p	CLIP-seq
MIRT1467419	hsa-miR-522	CLIP-seq
MIRT1467420	hsa-miR-542-3p	CLIP-seq
MIRT1467421	hsa-miR-646	CLIP-seq
MIRT1467422	hsa-miR-649	CLIP-seq
MIRT1467402	hsa-miR-877	CLIP-seq
MIRT1467403	hsa-miR-889	CLIP-seq
MIRT1467404	hsa-miR-1236	CLIP-seq
MIRT2140459	hsa-miR-1273d	CLIP-seq
MIRT2140460	hsa-miR-181a	CLIP-seq
MIRT2140461	hsa-miR-181b	CLIP-seq
MIRT2140462	hsa-miR-181c	CLIP-seq
MIRT2140463	hsa-miR-181d	CLIP-seq
MIRT1467406	hsa-miR-3182	CLIP-seq
MIRT2140464	hsa-miR-3651	CLIP-seq
MIRT2140465	hsa-miR-3686	CLIP-seq
MIRT2140466	hsa-miR-376c	CLIP-seq
MIRT2140467	hsa-miR-4262	CLIP-seq
MIRT1467410	hsa-miR-4504	CLIP-seq
MIRT2140468	hsa-miR-4652-3p	CLIP-seq
MIRT1467412	hsa-miR-4660	CLIP-seq
MIRT1467413	hsa-miR-4677-3p	CLIP-seq
MIRT1467414	hsa-miR-4679	CLIP-seq
MIRT1467420	hsa-miR-542-3p	CLIP-seq
MIRT1467399	hsa-miR-548n	CLIP-seq
MIRT2140469	hsa-miR-562	CLIP-seq
MIRT1467421	hsa-miR-646	CLIP-seq
MIRT2140470	hsa-miR-660	CLIP-seq
MIRT1467403	hsa-miR-889	CLIP-seq
MIRT1467404	hsa-miR-1236	CLIP-seq
MIRT1467406	hsa-miR-3182	CLIP-seq
MIRT1467410	hsa-miR-4504	CLIP-seq
MIRT1467412	hsa-miR-4660	CLIP-seq
MIRT1467413	hsa-miR-4677-3p	CLIP-seq
MIRT1467414	hsa-miR-4679	CLIP-seq
MIRT1467420	hsa-miR-542-3p	CLIP-seq
MIRT1467421	hsa-miR-646	CLIP-seq
MIRT2655032	hsa-miR-1183	CLIP-seq
MIRT2655033	hsa-miR-3065-5p	CLIP-seq
MIRT2655034	hsa-miR-3120-5p	CLIP-seq
MIRT2655035	hsa-miR-3137	CLIP-seq
MIRT2655036	hsa-miR-3618	CLIP-seq
MIRT1467393	hsa-miR-4427	CLIP-seq
MIRT1467394	hsa-miR-4432	CLIP-seq
MIRT2655037	hsa-miR-4496	CLIP-seq
MIRT1467395	hsa-miR-4499	CLIP-seq
MIRT2655038	hsa-miR-451b	CLIP-seq
MIRT2655039	hsa-miR-4778-5p	CLIP-seq
MIRT1467397	hsa-miR-499-5p	CLIP-seq
MIRT1467399	hsa-miR-548n	CLIP-seq
MIRT2655040	hsa-miR-548t	CLIP-seq
MIRT2655041	hsa-miR-556-3p	CLIP-seq
MIRT2655042	hsa-miR-590-3p	CLIP-seq
MIRT1467403	hsa-miR-889	CLIP-seq
MIRT2655043	hsa-miR-934	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	16307923
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	15247280, 16522193
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	16307923, 16522193, 20061386
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	8576257
GO:0005515	Function	Protein binding	IPI	16307923, 19549727, 19690564, 24446487, 26752685, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18845142
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	8576257
GO:0006513	Process	Protein monoubiquitination	IDA	27237050
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	39096901
GO:0016567	Process	Protein ubiquitination	IDA	9990509
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032020	Process	ISG15-protein conjugation	IBA
GO:0032020	Process	ISG15-protein conjugation	IDA	16428300
GO:0042296	Function	ISG15 transferase activity	IBA
GO:0042296	Function	ISG15 transferase activity	IDA	16428300
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16307923
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	15247280, 20061386, 27237050
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IEA

MIM	HGNC	e!Ensembl
602916	12477	ENSG00000170142

P51965

Protein name

Ubiquitin-conjugating enzyme E2 E1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme E1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme E1) (UbcH6) (Ubiquitin carrier protein E1) (Ubiquitin-protein ligase E1)

Protein function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also c

PDB

1XR9 , 3BZH , 4JJQ , 5LBN , 6FGA , 8IYA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	51 → 188	Ubiquitin-conjugating enzyme	Domain

Sequence

MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT

Sequence length

193

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		ISG15 antiviral mechanism Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Synthesis of active ubiquitin: roles of E1 and E2 enzymes E3 ubiquitin ligases ubiquitinate target proteins Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne Vulgaris	Acne	GWASCAT_DG	24927181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	25580532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27855695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	27855695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27855695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	40722175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16314844, 28193700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34477128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	21139979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34347012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	18519031		★★★★★ ★☆☆☆☆ Found in Text Mining only

UBE2E1 (ubiquitin conjugating enzyme E2 E1)