Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7311
Gene name	Ubiquitin A-52 residue ribosomal protein fusion product 1
Gene symbol	UBA52
Synonyms (NCBI Gene)	CEP52HUBCEP52L40RPL40
Chromosome	19
Chromosome location	19p13.11
Summary	Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, a

466

Show/Hide all (466)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051853	hsa-let-7c-5p	CLASH	23622248
MIRT045345	hsa-miR-185-5p	CLASH	23622248
MIRT044819	hsa-miR-320a	CLASH	23622248
MIRT043902	hsa-miR-378a-3p	CLASH	23622248
MIRT041941	hsa-miR-484	CLASH	23622248
MIRT039613	hsa-miR-615-3p	CLASH	23622248
MIRT036240	hsa-miR-320b	CLASH	23622248
MIRT1466410	hsa-miR-10a	CLIP-seq
MIRT1466411	hsa-miR-10b	CLIP-seq
MIRT1466412	hsa-miR-1197	CLIP-seq
MIRT1466413	hsa-miR-1207-5p	CLIP-seq
MIRT1466414	hsa-miR-1224-5p	CLIP-seq
MIRT1466415	hsa-miR-1254	CLIP-seq
MIRT1466416	hsa-miR-1262	CLIP-seq
MIRT1466417	hsa-miR-1283	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466419	hsa-miR-1304	CLIP-seq
MIRT1466420	hsa-miR-1323	CLIP-seq
MIRT1466421	hsa-miR-149	CLIP-seq
MIRT1466422	hsa-miR-1827	CLIP-seq
MIRT1466423	hsa-miR-1908	CLIP-seq
MIRT1466424	hsa-miR-2054	CLIP-seq
MIRT1466425	hsa-miR-2114	CLIP-seq
MIRT1466426	hsa-miR-24	CLIP-seq
MIRT1466427	hsa-miR-2467-3p	CLIP-seq
MIRT1466428	hsa-miR-2467-5p	CLIP-seq
MIRT1466429	hsa-miR-2861	CLIP-seq
MIRT1466430	hsa-miR-302f	CLIP-seq
MIRT1466431	hsa-miR-3116	CLIP-seq
MIRT1466432	hsa-miR-3157-5p	CLIP-seq
MIRT1466433	hsa-miR-3174	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT1466435	hsa-miR-3188	CLIP-seq
MIRT1466436	hsa-miR-3202	CLIP-seq
MIRT1466437	hsa-miR-338-3p	CLIP-seq
MIRT1466438	hsa-miR-339-5p	CLIP-seq
MIRT1466439	hsa-miR-3612	CLIP-seq
MIRT1466440	hsa-miR-3667-5p	CLIP-seq
MIRT1466441	hsa-miR-3672	CLIP-seq
MIRT1466442	hsa-miR-3675-3p	CLIP-seq
MIRT1466443	hsa-miR-3690	CLIP-seq
MIRT1466444	hsa-miR-371-5p	CLIP-seq
MIRT1466445	hsa-miR-371b-5p	CLIP-seq
MIRT1466446	hsa-miR-3918	CLIP-seq
MIRT1466447	hsa-miR-3925-3p	CLIP-seq
MIRT1466448	hsa-miR-3929	CLIP-seq
MIRT1466449	hsa-miR-3945	CLIP-seq
MIRT1466450	hsa-miR-3975	CLIP-seq
MIRT1466451	hsa-miR-4257	CLIP-seq
MIRT1466452	hsa-miR-4282	CLIP-seq
MIRT1466453	hsa-miR-4284	CLIP-seq
MIRT1466454	hsa-miR-4310	CLIP-seq
MIRT1466455	hsa-miR-4419b	CLIP-seq
MIRT1466456	hsa-miR-4421	CLIP-seq
MIRT1466457	hsa-miR-4433	CLIP-seq
MIRT1466458	hsa-miR-4436b-3p	CLIP-seq
MIRT1466459	hsa-miR-4459	CLIP-seq
MIRT1466460	hsa-miR-4461	CLIP-seq
MIRT1466461	hsa-miR-4474-3p	CLIP-seq
MIRT1466462	hsa-miR-4475	CLIP-seq
MIRT1466463	hsa-miR-4478	CLIP-seq
MIRT1466464	hsa-miR-4493	CLIP-seq
MIRT1466465	hsa-miR-4501	CLIP-seq
MIRT1466466	hsa-miR-4504	CLIP-seq
MIRT1466467	hsa-miR-451b	CLIP-seq
MIRT1466468	hsa-miR-4533	CLIP-seq
MIRT1466469	hsa-miR-4537	CLIP-seq
MIRT1466470	hsa-miR-4638-3p	CLIP-seq
MIRT1466471	hsa-miR-4645-3p	CLIP-seq
MIRT1466472	hsa-miR-4649-3p	CLIP-seq
MIRT1466473	hsa-miR-4684-5p	CLIP-seq
MIRT1466474	hsa-miR-4685-5p	CLIP-seq
MIRT1466475	hsa-miR-4688	CLIP-seq
MIRT1466476	hsa-miR-4691-3p	CLIP-seq
MIRT1466477	hsa-miR-4695-5p	CLIP-seq
MIRT1466478	hsa-miR-4696	CLIP-seq
MIRT1466479	hsa-miR-4701-3p	CLIP-seq
MIRT1466480	hsa-miR-4722-5p	CLIP-seq
MIRT1466481	hsa-miR-4751	CLIP-seq
MIRT1466482	hsa-miR-4753-5p	CLIP-seq
MIRT1466483	hsa-miR-4761-3p	CLIP-seq
MIRT1466484	hsa-miR-4763-3p	CLIP-seq
MIRT1466485	hsa-miR-4768-3p	CLIP-seq
MIRT1466486	hsa-miR-4786-5p	CLIP-seq
MIRT1466487	hsa-miR-485-5p	CLIP-seq
MIRT1466488	hsa-miR-488	CLIP-seq
MIRT1466489	hsa-miR-490-3p	CLIP-seq
MIRT1466490	hsa-miR-495	CLIP-seq
MIRT1466491	hsa-miR-500a	CLIP-seq
MIRT1466492	hsa-miR-508-5p	CLIP-seq
MIRT1466493	hsa-miR-520a-5p	CLIP-seq
MIRT1466494	hsa-miR-525-5p	CLIP-seq
MIRT1466495	hsa-miR-542-3p	CLIP-seq
MIRT1466496	hsa-miR-548o	CLIP-seq
MIRT1466497	hsa-miR-548p	CLIP-seq
MIRT1466498	hsa-miR-552	CLIP-seq
MIRT1466499	hsa-miR-590-3p	CLIP-seq
MIRT1466500	hsa-miR-593	CLIP-seq
MIRT1466501	hsa-miR-596	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466503	hsa-miR-634	CLIP-seq
MIRT1466504	hsa-miR-650	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466506	hsa-miR-663	CLIP-seq
MIRT1466507	hsa-miR-665	CLIP-seq
MIRT1466508	hsa-miR-766	CLIP-seq
MIRT1466509	hsa-miR-769-5p	CLIP-seq
MIRT1466510	hsa-miR-921	CLIP-seq
MIRT1466511	hsa-miR-938	CLIP-seq
MIRT1466512	hsa-miR-940	CLIP-seq
MIRT1466412	hsa-miR-1197	CLIP-seq
MIRT2140206	hsa-miR-122	CLIP-seq
MIRT1466414	hsa-miR-1224-5p	CLIP-seq
MIRT2140207	hsa-miR-1225-3p	CLIP-seq
MIRT2140208	hsa-miR-1233	CLIP-seq
MIRT1466415	hsa-miR-1254	CLIP-seq
MIRT1466416	hsa-miR-1262	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466419	hsa-miR-1304	CLIP-seq
MIRT1466420	hsa-miR-1323	CLIP-seq
MIRT2140209	hsa-miR-135a	CLIP-seq
MIRT2140210	hsa-miR-135b	CLIP-seq
MIRT2140211	hsa-miR-145	CLIP-seq
MIRT1466422	hsa-miR-1827	CLIP-seq
MIRT2140212	hsa-miR-192	CLIP-seq
MIRT1466424	hsa-miR-2054	CLIP-seq
MIRT2140213	hsa-miR-215	CLIP-seq
MIRT1466428	hsa-miR-2467-5p	CLIP-seq
MIRT1466429	hsa-miR-2861	CLIP-seq
MIRT1466430	hsa-miR-302f	CLIP-seq
MIRT1466431	hsa-miR-3116	CLIP-seq
MIRT2140214	hsa-miR-3130-5p	CLIP-seq
MIRT2140215	hsa-miR-3145-5p	CLIP-seq
MIRT1466432	hsa-miR-3157-5p	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT1466435	hsa-miR-3188	CLIP-seq
MIRT2140216	hsa-miR-3194-5p	CLIP-seq
MIRT1466436	hsa-miR-3202	CLIP-seq
MIRT1466440	hsa-miR-3667-5p	CLIP-seq
MIRT1466442	hsa-miR-3675-3p	CLIP-seq
MIRT1466443	hsa-miR-3690	CLIP-seq
MIRT1466446	hsa-miR-3918	CLIP-seq
MIRT1466447	hsa-miR-3925-3p	CLIP-seq
MIRT1466450	hsa-miR-3975	CLIP-seq
MIRT2140217	hsa-miR-4292	CLIP-seq
MIRT2140218	hsa-miR-4308	CLIP-seq
MIRT2140219	hsa-miR-4328	CLIP-seq
MIRT1466457	hsa-miR-4433	CLIP-seq
MIRT1466459	hsa-miR-4459	CLIP-seq
MIRT1466460	hsa-miR-4461	CLIP-seq
MIRT1466462	hsa-miR-4475	CLIP-seq
MIRT2140220	hsa-miR-4482	CLIP-seq
MIRT1466464	hsa-miR-4493	CLIP-seq
MIRT1466467	hsa-miR-451b	CLIP-seq
MIRT2140221	hsa-miR-4520a-3p	CLIP-seq
MIRT1466468	hsa-miR-4533	CLIP-seq
MIRT1466470	hsa-miR-4638-3p	CLIP-seq
MIRT2140222	hsa-miR-4683	CLIP-seq
MIRT1466474	hsa-miR-4685-5p	CLIP-seq
MIRT1466476	hsa-miR-4691-3p	CLIP-seq
MIRT1466477	hsa-miR-4695-5p	CLIP-seq
MIRT1466478	hsa-miR-4696	CLIP-seq
MIRT1466479	hsa-miR-4701-3p	CLIP-seq
MIRT2140223	hsa-miR-4708-5p	CLIP-seq
MIRT1466480	hsa-miR-4722-5p	CLIP-seq
MIRT1466481	hsa-miR-4751	CLIP-seq
MIRT1466482	hsa-miR-4753-5p	CLIP-seq
MIRT2140224	hsa-miR-4786-3p	CLIP-seq
MIRT2140225	hsa-miR-4794	CLIP-seq
MIRT1466487	hsa-miR-485-5p	CLIP-seq
MIRT1466488	hsa-miR-488	CLIP-seq
MIRT1466489	hsa-miR-490-3p	CLIP-seq
MIRT1466491	hsa-miR-500a	CLIP-seq
MIRT1466492	hsa-miR-508-5p	CLIP-seq
MIRT2140226	hsa-miR-548ae	CLIP-seq
MIRT2140227	hsa-miR-548aj	CLIP-seq
MIRT2140228	hsa-miR-548am	CLIP-seq
MIRT1466496	hsa-miR-548o	CLIP-seq
MIRT2140229	hsa-miR-548x	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466507	hsa-miR-665	CLIP-seq
MIRT1466511	hsa-miR-938	CLIP-seq
MIRT1466410	hsa-miR-10a	CLIP-seq
MIRT1466411	hsa-miR-10b	CLIP-seq
MIRT1466412	hsa-miR-1197	CLIP-seq
MIRT1466414	hsa-miR-1224-5p	CLIP-seq
MIRT2360972	hsa-miR-1228	CLIP-seq
MIRT2360973	hsa-miR-1244	CLIP-seq
MIRT1466415	hsa-miR-1254	CLIP-seq
MIRT1466416	hsa-miR-1262	CLIP-seq
MIRT2360974	hsa-miR-1273	CLIP-seq
MIRT2360975	hsa-miR-127-5p	CLIP-seq
MIRT1466417	hsa-miR-1283	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466422	hsa-miR-1827	CLIP-seq
MIRT2140212	hsa-miR-192	CLIP-seq
MIRT2360976	hsa-miR-199a-3p	CLIP-seq
MIRT2360977	hsa-miR-199b-3p	CLIP-seq
MIRT2140213	hsa-miR-215	CLIP-seq
MIRT2360978	hsa-miR-217	CLIP-seq
MIRT1466430	hsa-miR-302f	CLIP-seq
MIRT1466431	hsa-miR-3116	CLIP-seq
MIRT2360979	hsa-miR-3129-5p	CLIP-seq
MIRT1466432	hsa-miR-3157-5p	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT2140216	hsa-miR-3194-5p	CLIP-seq
MIRT1466438	hsa-miR-339-5p	CLIP-seq
MIRT1466440	hsa-miR-3667-5p	CLIP-seq
MIRT1466442	hsa-miR-3675-3p	CLIP-seq
MIRT1466443	hsa-miR-3690	CLIP-seq
MIRT2360980	hsa-miR-3926	CLIP-seq
MIRT2360981	hsa-miR-4252	CLIP-seq
MIRT1466456	hsa-miR-4421	CLIP-seq
MIRT2360982	hsa-miR-4432	CLIP-seq
MIRT1466457	hsa-miR-4433	CLIP-seq
MIRT1466459	hsa-miR-4459	CLIP-seq
MIRT2360983	hsa-miR-4486	CLIP-seq
MIRT1466467	hsa-miR-451b	CLIP-seq
MIRT1466470	hsa-miR-4638-3p	CLIP-seq
MIRT2360984	hsa-miR-4649-5p	CLIP-seq
MIRT1466473	hsa-miR-4684-5p	CLIP-seq
MIRT1466476	hsa-miR-4691-3p	CLIP-seq
MIRT1466478	hsa-miR-4696	CLIP-seq
MIRT1466479	hsa-miR-4701-3p	CLIP-seq
MIRT1466480	hsa-miR-4722-5p	CLIP-seq
MIRT2360985	hsa-miR-4740-3p	CLIP-seq
MIRT1466481	hsa-miR-4751	CLIP-seq
MIRT1466485	hsa-miR-4768-3p	CLIP-seq
MIRT2140224	hsa-miR-4786-3p	CLIP-seq
MIRT2360986	hsa-miR-4793-3p	CLIP-seq
MIRT1466487	hsa-miR-485-5p	CLIP-seq
MIRT1466492	hsa-miR-508-5p	CLIP-seq
MIRT2140226	hsa-miR-548ae	CLIP-seq
MIRT2140227	hsa-miR-548aj	CLIP-seq
MIRT2140228	hsa-miR-548am	CLIP-seq
MIRT1466497	hsa-miR-548p	CLIP-seq
MIRT2360987	hsa-miR-548s	CLIP-seq
MIRT2140229	hsa-miR-548x	CLIP-seq
MIRT1466500	hsa-miR-593	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466507	hsa-miR-665	CLIP-seq
MIRT1466508	hsa-miR-766	CLIP-seq
MIRT2360988	hsa-miR-936	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466424	hsa-miR-2054	CLIP-seq
MIRT1466429	hsa-miR-2861	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT1466459	hsa-miR-4459	CLIP-seq
MIRT1466477	hsa-miR-4695-5p	CLIP-seq
MIRT1466480	hsa-miR-4722-5p	CLIP-seq
MIRT1466487	hsa-miR-485-5p	CLIP-seq
MIRT1466491	hsa-miR-500a	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466511	hsa-miR-938	CLIP-seq
MIRT2466288	hsa-miR-1273d	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466420	hsa-miR-1323	CLIP-seq
MIRT2140214	hsa-miR-3130-5p	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT2140216	hsa-miR-3194-5p	CLIP-seq
MIRT2466289	hsa-miR-3613-3p	CLIP-seq
MIRT1466440	hsa-miR-3667-5p	CLIP-seq
MIRT1466444	hsa-miR-371-5p	CLIP-seq
MIRT1466445	hsa-miR-371b-5p	CLIP-seq
MIRT2360982	hsa-miR-4432	CLIP-seq
MIRT1466457	hsa-miR-4433	CLIP-seq
MIRT2140220	hsa-miR-4482	CLIP-seq
MIRT1466467	hsa-miR-451b	CLIP-seq
MIRT2466290	hsa-miR-4662a-5p	CLIP-seq
MIRT2466291	hsa-miR-4676-5p	CLIP-seq
MIRT1466473	hsa-miR-4684-5p	CLIP-seq
MIRT1466478	hsa-miR-4696	CLIP-seq
MIRT2140224	hsa-miR-4786-3p	CLIP-seq
MIRT1466490	hsa-miR-495	CLIP-seq
MIRT2466292	hsa-miR-548c-3p	CLIP-seq
MIRT1466496	hsa-miR-548o	CLIP-seq
MIRT2466293	hsa-miR-575	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466507	hsa-miR-665	CLIP-seq
MIRT1466410	hsa-miR-10a	CLIP-seq
MIRT1466411	hsa-miR-10b	CLIP-seq
MIRT2654455	hsa-miR-1226	CLIP-seq
MIRT1466415	hsa-miR-1254	CLIP-seq
MIRT2654456	hsa-miR-1265	CLIP-seq
MIRT2360974	hsa-miR-1273	CLIP-seq
MIRT2466288	hsa-miR-1273d	CLIP-seq
MIRT2654457	hsa-miR-1273e	CLIP-seq
MIRT1466417	hsa-miR-1283	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466419	hsa-miR-1304	CLIP-seq
MIRT1466420	hsa-miR-1323	CLIP-seq
MIRT1466422	hsa-miR-1827	CLIP-seq
MIRT2654458	hsa-miR-193a-3p	CLIP-seq
MIRT2654459	hsa-miR-193b	CLIP-seq
MIRT2654460	hsa-miR-197	CLIP-seq
MIRT1466424	hsa-miR-2054	CLIP-seq
MIRT2654461	hsa-miR-2392	CLIP-seq
MIRT1466431	hsa-miR-3116	CLIP-seq
MIRT2654462	hsa-miR-3122	CLIP-seq
MIRT2654463	hsa-miR-3130-3p	CLIP-seq
MIRT2140214	hsa-miR-3130-5p	CLIP-seq
MIRT2654464	hsa-miR-3136-3p	CLIP-seq
MIRT1466433	hsa-miR-3174	CLIP-seq
MIRT2654465	hsa-miR-3176	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT2140216	hsa-miR-3194-5p	CLIP-seq
MIRT1466436	hsa-miR-3202	CLIP-seq
MIRT1466438	hsa-miR-339-5p	CLIP-seq
MIRT2466289	hsa-miR-3613-3p	CLIP-seq
MIRT1466440	hsa-miR-3667-5p	CLIP-seq
MIRT1466442	hsa-miR-3675-3p	CLIP-seq
MIRT2654466	hsa-miR-3689a-3p	CLIP-seq
MIRT2654467	hsa-miR-3689c	CLIP-seq
MIRT1466443	hsa-miR-3690	CLIP-seq
MIRT1466444	hsa-miR-371-5p	CLIP-seq
MIRT1466445	hsa-miR-371b-5p	CLIP-seq
MIRT2654468	hsa-miR-3913-5p	CLIP-seq
MIRT2654469	hsa-miR-3922-3p	CLIP-seq
MIRT2654470	hsa-miR-412	CLIP-seq
MIRT2360981	hsa-miR-4252	CLIP-seq
MIRT2654471	hsa-miR-4258	CLIP-seq
MIRT2654472	hsa-miR-4300	CLIP-seq
MIRT1466456	hsa-miR-4421	CLIP-seq
MIRT2654473	hsa-miR-4428	CLIP-seq
MIRT2360982	hsa-miR-4432	CLIP-seq
MIRT1466457	hsa-miR-4433	CLIP-seq
MIRT2140220	hsa-miR-4482	CLIP-seq
MIRT2360983	hsa-miR-4486	CLIP-seq
MIRT1466464	hsa-miR-4493	CLIP-seq
MIRT1466467	hsa-miR-451b	CLIP-seq
MIRT1466468	hsa-miR-4533	CLIP-seq
MIRT1466470	hsa-miR-4638-3p	CLIP-seq
MIRT2360984	hsa-miR-4649-5p	CLIP-seq
MIRT2466290	hsa-miR-4662a-5p	CLIP-seq
MIRT2466291	hsa-miR-4676-5p	CLIP-seq
MIRT1466473	hsa-miR-4684-5p	CLIP-seq
MIRT1466478	hsa-miR-4696	CLIP-seq
MIRT2654474	hsa-miR-4708-3p	CLIP-seq
MIRT2654475	hsa-miR-4711-5p	CLIP-seq
MIRT2654476	hsa-miR-4728-5p	CLIP-seq
MIRT2654477	hsa-miR-4733-3p	CLIP-seq
MIRT2654478	hsa-miR-4733-5p	CLIP-seq
MIRT2360985	hsa-miR-4740-3p	CLIP-seq
MIRT2654479	hsa-miR-4757-5p	CLIP-seq
MIRT2140224	hsa-miR-4786-3p	CLIP-seq
MIRT1466486	hsa-miR-4786-5p	CLIP-seq
MIRT2360986	hsa-miR-4793-3p	CLIP-seq
MIRT1466487	hsa-miR-485-5p	CLIP-seq
MIRT1466490	hsa-miR-495	CLIP-seq
MIRT1466491	hsa-miR-500a	CLIP-seq
MIRT1466492	hsa-miR-508-5p	CLIP-seq
MIRT2654480	hsa-miR-517a	CLIP-seq
MIRT2654481	hsa-miR-517b	CLIP-seq
MIRT2654482	hsa-miR-517c	CLIP-seq
MIRT2654483	hsa-miR-539	CLIP-seq
MIRT2654484	hsa-miR-548ac	CLIP-seq
MIRT2140226	hsa-miR-548ae	CLIP-seq
MIRT2140227	hsa-miR-548aj	CLIP-seq
MIRT2140228	hsa-miR-548am	CLIP-seq
MIRT2466292	hsa-miR-548c-3p	CLIP-seq
MIRT2654485	hsa-miR-548d-3p	CLIP-seq
MIRT1466496	hsa-miR-548o	CLIP-seq
MIRT1466497	hsa-miR-548p	CLIP-seq
MIRT2140229	hsa-miR-548x	CLIP-seq
MIRT2654486	hsa-miR-548z	CLIP-seq
MIRT2466293	hsa-miR-575	CLIP-seq
MIRT1466500	hsa-miR-593	CLIP-seq
MIRT2654487	hsa-miR-604	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466503	hsa-miR-634	CLIP-seq
MIRT2654488	hsa-miR-651	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466507	hsa-miR-665	CLIP-seq
MIRT1466508	hsa-miR-766	CLIP-seq
MIRT1466509	hsa-miR-769-5p	CLIP-seq
MIRT2654489	hsa-miR-920	CLIP-seq
MIRT1466510	hsa-miR-921	CLIP-seq
MIRT1466410	hsa-miR-10a	CLIP-seq
MIRT1466411	hsa-miR-10b	CLIP-seq
MIRT2654455	hsa-miR-1226	CLIP-seq
MIRT2654456	hsa-miR-1265	CLIP-seq
MIRT2360974	hsa-miR-1273	CLIP-seq
MIRT2466288	hsa-miR-1273d	CLIP-seq
MIRT2654457	hsa-miR-1273e	CLIP-seq
MIRT1466417	hsa-miR-1283	CLIP-seq
MIRT1466418	hsa-miR-1285	CLIP-seq
MIRT1466419	hsa-miR-1304	CLIP-seq
MIRT1466420	hsa-miR-1323	CLIP-seq
MIRT2654458	hsa-miR-193a-3p	CLIP-seq
MIRT2654459	hsa-miR-193b	CLIP-seq
MIRT2654460	hsa-miR-197	CLIP-seq
MIRT1466424	hsa-miR-2054	CLIP-seq
MIRT2654461	hsa-miR-2392	CLIP-seq
MIRT2654462	hsa-miR-3122	CLIP-seq
MIRT2654463	hsa-miR-3130-3p	CLIP-seq
MIRT2140214	hsa-miR-3130-5p	CLIP-seq
MIRT2654464	hsa-miR-3136-3p	CLIP-seq
MIRT2654465	hsa-miR-3176	CLIP-seq
MIRT1466434	hsa-miR-3187-5p	CLIP-seq
MIRT2140216	hsa-miR-3194-5p	CLIP-seq
MIRT1466438	hsa-miR-339-5p	CLIP-seq
MIRT2466289	hsa-miR-3613-3p	CLIP-seq
MIRT1466440	hsa-miR-3667-5p	CLIP-seq
MIRT1466442	hsa-miR-3675-3p	CLIP-seq
MIRT2654466	hsa-miR-3689a-3p	CLIP-seq
MIRT2654467	hsa-miR-3689c	CLIP-seq
MIRT1466444	hsa-miR-371-5p	CLIP-seq
MIRT1466445	hsa-miR-371b-5p	CLIP-seq
MIRT2654468	hsa-miR-3913-5p	CLIP-seq
MIRT2654469	hsa-miR-3922-3p	CLIP-seq
MIRT2360980	hsa-miR-3926	CLIP-seq
MIRT2654470	hsa-miR-412	CLIP-seq
MIRT2360981	hsa-miR-4252	CLIP-seq
MIRT2654471	hsa-miR-4258	CLIP-seq
MIRT2654472	hsa-miR-4300	CLIP-seq
MIRT1466456	hsa-miR-4421	CLIP-seq
MIRT2360982	hsa-miR-4432	CLIP-seq
MIRT1466457	hsa-miR-4433	CLIP-seq
MIRT2140220	hsa-miR-4482	CLIP-seq
MIRT2360983	hsa-miR-4486	CLIP-seq
MIRT1466467	hsa-miR-451b	CLIP-seq
MIRT2360984	hsa-miR-4649-5p	CLIP-seq
MIRT2466290	hsa-miR-4662a-5p	CLIP-seq
MIRT2466291	hsa-miR-4676-5p	CLIP-seq
MIRT1466473	hsa-miR-4684-5p	CLIP-seq
MIRT1466478	hsa-miR-4696	CLIP-seq
MIRT2654474	hsa-miR-4708-3p	CLIP-seq
MIRT2654475	hsa-miR-4711-5p	CLIP-seq
MIRT2654476	hsa-miR-4728-5p	CLIP-seq
MIRT2654477	hsa-miR-4733-3p	CLIP-seq
MIRT2654478	hsa-miR-4733-5p	CLIP-seq
MIRT2654479	hsa-miR-4757-5p	CLIP-seq
MIRT2140224	hsa-miR-4786-3p	CLIP-seq
MIRT2360986	hsa-miR-4793-3p	CLIP-seq
MIRT1466487	hsa-miR-485-5p	CLIP-seq
MIRT1466490	hsa-miR-495	CLIP-seq
MIRT1466491	hsa-miR-500a	CLIP-seq
MIRT1466492	hsa-miR-508-5p	CLIP-seq
MIRT2654480	hsa-miR-517a	CLIP-seq
MIRT2654481	hsa-miR-517b	CLIP-seq
MIRT2654482	hsa-miR-517c	CLIP-seq
MIRT2654484	hsa-miR-548ac	CLIP-seq
MIRT2140226	hsa-miR-548ae	CLIP-seq
MIRT2140227	hsa-miR-548aj	CLIP-seq
MIRT2140228	hsa-miR-548am	CLIP-seq
MIRT2466292	hsa-miR-548c-3p	CLIP-seq
MIRT2654485	hsa-miR-548d-3p	CLIP-seq
MIRT1466496	hsa-miR-548o	CLIP-seq
MIRT1466497	hsa-miR-548p	CLIP-seq
MIRT2360987	hsa-miR-548s	CLIP-seq
MIRT2140229	hsa-miR-548x	CLIP-seq
MIRT2654486	hsa-miR-548z	CLIP-seq
MIRT2466293	hsa-miR-575	CLIP-seq
MIRT1466500	hsa-miR-593	CLIP-seq
MIRT2654487	hsa-miR-604	CLIP-seq
MIRT1466502	hsa-miR-612	CLIP-seq
MIRT1466503	hsa-miR-634	CLIP-seq
MIRT2654488	hsa-miR-651	CLIP-seq
MIRT1466505	hsa-miR-661	CLIP-seq
MIRT1466507	hsa-miR-665	CLIP-seq
MIRT1466508	hsa-miR-766	CLIP-seq
MIRT2654489	hsa-miR-920	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IC	23636399
GO:0002181	Process	Cytoplasmic translation	IDA	39048817
GO:0002181	Process	Cytoplasmic translation	NAS	25901680
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IDA	23636399, 32669547, 39048817
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	12962325
GO:0005515	Function	Protein binding	IPI	15147878, 15231748, 15936278, 19549727, 21900206, 32296183, 32814053, 33961781, 35271311
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	25901680
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	NAS	12962325
GO:0010008	Component	Endosome membrane	TAS
GO:0015934	Component	Large ribosomal subunit	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0017085	Process	Response to insecticide	IEA
GO:0019941	Process	Modification-dependent protein catabolic process	IBA
GO:0022625	Component	Cytosolic large ribosomal subunit	HDA	12962325
GO:0022625	Component	Cytosolic large ribosomal subunit	IDA	32669547
GO:0022625	Component	Cytosolic large ribosomal subunit	IEA
GO:0022625	Component	Cytosolic large ribosomal subunit	IPI	25901680
GO:0022626	Component	Cytosolic ribosome	IDA	39048817
GO:0022626	Component	Cytosolic ribosome	IDA	23636399
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031386	Function	Protein tag activity	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0036211	Process	Protein modification process	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
191321	12458	ENSG00000221983

P62987

Protein name

Ubiquitin-ribosomal protein eL40 fusion protein (CEP52) (Ubiquitin A-52 residue ribosomal protein fusion product 1) [Cleaved into: Ubiquitin; Large ribosomal subunit protein eL40 (60S ribosomal protein L40) (rpL40)]

Protein function

[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys re

PDB

2LJ5 , 2MBH , 2MJB , 2MUR , 2N3U , 2N3V , 2N3W , 2NBD , 2NBE , 2RSU , 4HJK , 4JIO , 4P4H , 4PIG , 4PIH , 4PIJ , 4RF0 , 4RF1 , 4S1Z , 4UG0 , 4V6X , 4XKL , 5AJ0 , 5GO7 , 5GO8 , 5GOB , 5GOC , 5GOD , 5GOG , 5GOH , 5GOI , 5GOJ , 5GOK , 5HPK , 5HPL , 5HPS , 5HPT , 5J26 , 5J8P , 5JBV , 5JBY , 5LKS , 5T2C , 6IP5 , 6IP6 , 6IP8 , 6LQM , 6OLE , 6OLF , 6OLG , 6OLI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
PF01020	Ribosomal_L40e	78 → 127	Ribosomal L40e family	Family

Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK

Sequence length

128

Interactions

View interactions

	KEGG		Reactome
	Ribosome Ubiquitin mediated proteolysis Mitophagy - animal Autophagy - animal Parkinson disease Pathways of neurodegeneration - multiple diseases Shigellosis Kaposi sarcoma-associated herpesvirus infection Coronavirus disease - COVID-19		Translesion synthesis by REV1 Recognition of DNA damage by PCNA-containing replication complex Translesion Synthesis by POLH Activation of NF-kappaB in B cells ISG15 antiviral mechanism Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants Downregulation of ERBB4 signaling Spry regulation of FGF signaling Downregulation of ERBB2:ERBB3 signaling L13a-mediated translational silencing of Ceruloplasmin expression Budding and maturation of HIV virion NOD1/2 Signaling Pathway TICAM1, RIP1-mediated IKK complex recruitment DDX58/IFIH1-mediated induction of interferon-alpha/beta APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Membrane binding and targetting of GAG proteins Assembly Of The HIV Virion APC-Cdc20 mediated degradation of Nek2A SRP-dependent cotranslational protein targeting to membrane Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G EGFR downregulation SCF(Skp2)-mediated degradation of p27/p21 Viral mRNA Translation Degradation of beta-catenin by the destruction complex TCF dependent signaling in response to WNT Downstream TCR signaling NRIF signals cell death from the nucleus p75NTR recruits signalling complexes NF-kB is activated and signals survival Activated NOTCH1 Transmits Signal to the Nucleus Downregulation of TGF-beta receptor signaling TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) Downregulation of SMAD2/3:SMAD4 transcriptional activity SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Separation of Sister Chromatids Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) Oncogene Induced Senescence Regulation of PLK1 Activity at G2/M Transition Constitutive Signaling by NOTCH1 PEST Domain Mutants Stimuli-sensing channels Constitutive Signaling by NOTCH1 HD Domain Mutants FCERI mediated NF-kB activation Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Regulation of innate immune responses to cytosolic DNA Glycogen synthesis Autodegradation of the E3 ubiquitin ligase COP1 Deactivation of the beta-catenin transactivating complex Myoclonic epilepsy of Lafora ABC-family proteins mediated transport TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Regulation of FZD by ubiquitination Pink/Parkin Mediated Mitophagy N-glycan trimming in the ER and Calnexin/Calreticulin cycle Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Translesion synthesis by POLK Translesion synthesis by POLI Termination of translesion DNA synthesis Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway Negative regulation of MAPK pathway Regulation of necroptotic cell death NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAP3K8 (TPL2)-dependent MAPK1/3 activation HDR through Homologous Recombination (HRR) MAPK6/MAPK4 signaling UCH proteinases Josephin domain DUBs Ub-specific processing proteases Ovarian tumor domain proteases Metalloprotease DUBs Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Processing of DNA double-strand break ends DNA Damage Recognition in GG-NER Formation of Incision Complex in GG-NER Gap-filling DNA repair synthesis and ligation in GG-NER Dual Incision in GG-NER Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Fanconi Anemia Pathway Major pathway of rRNA processing in the nucleolus and cytosol Regulation of TP53 Activity through Phosphorylation Regulation of TP53 Degradation Regulation of TP53 Activity through Methylation Negative regulation of MET activity CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 Cyclin D associated events in G1 G2/M Checkpoints Stabilization of p53 Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Formation of a pool of free 40S subunits GTP hydrolysis and joining of the 60S ribosomal subunit Ubiquitin-dependent degradation of Cyclin D PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1 The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Downregulation of ERBB2 signaling Synthesis of active ubiquitin: roles of E1 and E2 enzymes E3 ubiquitin ligases ubiquitinate target proteins InlB-mediated entry of Listeria monocytogenes into host cell InlA-mediated entry of Listeria monocytogenes into host cells RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN localization Regulation of PTEN stability and activity Neddylation ER Quality Control Compartment (ERQC) Regulation of expression of SLITs and ROBOs NOTCH3 Activation and Transmission of Signal to the Nucleus TICAM1-dependent activation of IRF3/IRF7 TICAM1,TRAF6-dependent induction of TAK1 complex Interleukin-1 signaling Peroxisomal protein import Regulation of signaling by CBL Endosomal Sorting Complex Required For Transport (ESCRT) Iron uptake and transport Negative regulators of DDX58/IFIH1 signaling Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon IRAK1 recruits IKK complex IKK complex recruitment mediated by RIP1 IRAK2 mediated activation of TAK1 complex TRAF6-mediated induction of TAK1 complex within TLR4 complex Prevention of phagosomal-lysosomal fusion Modulation by Mtb of host immune system Alpha-protein kinase 1 signaling pathway Aggrephagy Pexophagy TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) Amyloid fiber formation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, SPINE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32812532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35751199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22258406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33399095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32812532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	8541345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30690837, 8541345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30690837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component C1s Deficiency	Complement component deficiency	Pubtator	31537905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	34856750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31775867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20725696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28849145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36369953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	33761671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31537905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	28849145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	8541345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	8541345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35536760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33795012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31814919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	20725696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38166541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25183411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	40016701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	8541345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34135559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UBA52 (ubiquitin A-52 residue ribosomal protein fusion product 1)