TYRO3 (TYRO3 protein tyrosine kinase)

Gene

• Entrez ID: 7301
• Gene name: TYRO3 protein tyrosine kinase
• Gene symbol: TYRO3
• Synonyms (NCBI Gene): BYK, Dtk, Etk-2, RSE, Rek, Sky, Tif
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT719578	hsa-miR-6871-3p	HITS-CLIP	19536157
MIRT719577	hsa-miR-3065-3p	HITS-CLIP	19536157
MIRT719576	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT719575	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT719574	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT719573	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT719572	hsa-miR-149-5p	HITS-CLIP	19536157
MIRT719571	hsa-miR-5580-5p	HITS-CLIP	19536157
MIRT719570	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT719569	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT719568	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT696023	hsa-miR-4781-3p	HITS-CLIP	23313552
MIRT696022	hsa-miR-4716-5p	HITS-CLIP	23313552
MIRT696021	hsa-miR-4732-3p	HITS-CLIP	23313552
MIRT696020	hsa-miR-3663-5p	HITS-CLIP	23313552
MIRT696019	hsa-miR-4635	HITS-CLIP	23313552
MIRT696018	hsa-miR-4755-3p	HITS-CLIP	23313552
MIRT696017	hsa-miR-6131	HITS-CLIP	23313552
MIRT696016	hsa-miR-197-3p	HITS-CLIP	23313552
MIRT696015	hsa-miR-548s	HITS-CLIP	23313552
MIRT696014	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT696013	hsa-miR-588	HITS-CLIP	23313552
MIRT696012	hsa-miR-4435	HITS-CLIP	23313552
MIRT696011	hsa-miR-3187-3p	HITS-CLIP	23313552
MIRT696010	hsa-miR-5096	HITS-CLIP	23313552
MIRT520404	hsa-miR-518a-3p	PAR-CLIP	23446348
MIRT520403	hsa-miR-518b	PAR-CLIP	23446348
MIRT520402	hsa-miR-518c-3p	PAR-CLIP	23446348
MIRT520401	hsa-miR-518d-3p	PAR-CLIP	23446348
MIRT520400	hsa-miR-518f-3p	PAR-CLIP	23446348
MIRT520399	hsa-miR-518e-3p	PAR-CLIP	23446348
MIRT520398	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT520397	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT520396	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT520395	hsa-miR-4455	PAR-CLIP	23446348
MIRT520394	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT520393	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT719578	hsa-miR-6871-3p	HITS-CLIP	19536157
MIRT719577	hsa-miR-3065-3p	HITS-CLIP	19536157
MIRT719576	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT719575	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT719574	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT719573	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT719572	hsa-miR-149-5p	HITS-CLIP	19536157
MIRT719571	hsa-miR-5580-5p	HITS-CLIP	19536157
MIRT719570	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT719569	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT719568	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT696023	hsa-miR-4781-3p	HITS-CLIP	23313552
MIRT696022	hsa-miR-4716-5p	HITS-CLIP	23313552
MIRT696021	hsa-miR-4732-3p	HITS-CLIP	23313552
MIRT696020	hsa-miR-3663-5p	HITS-CLIP	23313552
MIRT696019	hsa-miR-4635	HITS-CLIP	23313552
MIRT696018	hsa-miR-4755-3p	HITS-CLIP	23313552
MIRT696017	hsa-miR-6131	HITS-CLIP	23313552
MIRT696016	hsa-miR-197-3p	HITS-CLIP	23313552
MIRT696015	hsa-miR-548s	HITS-CLIP	23313552
MIRT696014	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT696013	hsa-miR-588	HITS-CLIP	23313552
MIRT696012	hsa-miR-4435	HITS-CLIP	23313552
MIRT696011	hsa-miR-3187-3p	HITS-CLIP	23313552
MIRT696010	hsa-miR-5096	HITS-CLIP	23313552
MIRT520404	hsa-miR-518a-3p	PAR-CLIP	23446348
MIRT520403	hsa-miR-518b	PAR-CLIP	23446348
MIRT520402	hsa-miR-518c-3p	PAR-CLIP	23446348
MIRT520401	hsa-miR-518d-3p	PAR-CLIP	23446348
MIRT520400	hsa-miR-518f-3p	PAR-CLIP	23446348
MIRT520399	hsa-miR-518e-3p	PAR-CLIP	23446348
MIRT520398	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT520397	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT520396	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT520395	hsa-miR-4455	PAR-CLIP	23446348
MIRT520394	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT520393	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT1465652	hsa-miR-1285	CLIP-seq
MIRT1465653	hsa-miR-1343	CLIP-seq
MIRT1465654	hsa-miR-2467-5p	CLIP-seq
MIRT1465655	hsa-miR-3135b	CLIP-seq
MIRT1465656	hsa-miR-3140-5p	CLIP-seq
MIRT1465657	hsa-miR-3145-3p	CLIP-seq
MIRT1465658	hsa-miR-3180-5p	CLIP-seq
MIRT1465659	hsa-miR-3183	CLIP-seq
MIRT1465660	hsa-miR-3187-5p	CLIP-seq
MIRT1465661	hsa-miR-3189-5p	CLIP-seq
MIRT1465662	hsa-miR-3614-5p	CLIP-seq
MIRT1465663	hsa-miR-3652	CLIP-seq
MIRT1465664	hsa-miR-3978	CLIP-seq
MIRT1465665	hsa-miR-4268	CLIP-seq
MIRT1465666	hsa-miR-4430	CLIP-seq
MIRT1465667	hsa-miR-4443	CLIP-seq
MIRT1465668	hsa-miR-4448	CLIP-seq
MIRT1465669	hsa-miR-4453	CLIP-seq
MIRT1465670	hsa-miR-4536	CLIP-seq
MIRT1465671	hsa-miR-4538	CLIP-seq
MIRT1465672	hsa-miR-4539	CLIP-seq
MIRT1465673	hsa-miR-4640-5p	CLIP-seq
MIRT1465674	hsa-miR-4680-5p	CLIP-seq
MIRT1465675	hsa-miR-4723-3p	CLIP-seq
MIRT1465676	hsa-miR-4726-5p	CLIP-seq
MIRT1465677	hsa-miR-4733-3p	CLIP-seq
MIRT1465678	hsa-miR-520a-5p	CLIP-seq
MIRT1465679	hsa-miR-525-5p	CLIP-seq
MIRT1465680	hsa-miR-586	CLIP-seq
MIRT1465681	hsa-miR-595	CLIP-seq
MIRT1465682	hsa-miR-612	CLIP-seq
MIRT2139977	hsa-miR-1587	CLIP-seq
MIRT1465654	hsa-miR-2467-5p	CLIP-seq
MIRT1465655	hsa-miR-3135b	CLIP-seq
MIRT1465658	hsa-miR-3180-5p	CLIP-seq
MIRT1465661	hsa-miR-3189-5p	CLIP-seq
MIRT2139978	hsa-miR-361-3p	CLIP-seq
MIRT1465663	hsa-miR-3652	CLIP-seq
MIRT2139979	hsa-miR-3677-5p	CLIP-seq
MIRT2139980	hsa-miR-3926	CLIP-seq
MIRT1465664	hsa-miR-3978	CLIP-seq
MIRT1465666	hsa-miR-4430	CLIP-seq
MIRT1465667	hsa-miR-4443	CLIP-seq
MIRT1465669	hsa-miR-4453	CLIP-seq
MIRT2139981	hsa-miR-4474-5p	CLIP-seq
MIRT1465671	hsa-miR-4538	CLIP-seq
MIRT2139982	hsa-miR-4660	CLIP-seq
MIRT1465678	hsa-miR-520a-5p	CLIP-seq
MIRT1465679	hsa-miR-525-5p	CLIP-seq
MIRT1465680	hsa-miR-586	CLIP-seq
MIRT2139983	hsa-miR-651	CLIP-seq
MIRT2360658	hsa-miR-1225-5p	CLIP-seq
MIRT2360659	hsa-miR-3145-5p	CLIP-seq
MIRT2360660	hsa-miR-338-3p	CLIP-seq
MIRT1465664	hsa-miR-3978	CLIP-seq
MIRT1465669	hsa-miR-4453	CLIP-seq
MIRT2360661	hsa-miR-4505	CLIP-seq
MIRT2360662	hsa-miR-4530	CLIP-seq
MIRT1465671	hsa-miR-4538	CLIP-seq
MIRT2360663	hsa-miR-508-5p	CLIP-seq
MIRT2360664	hsa-miR-766	CLIP-seq
MIRT2396558	hsa-miR-149	CLIP-seq
MIRT2654232	hsa-miR-1205	CLIP-seq
MIRT2654233	hsa-miR-1207-3p	CLIP-seq
MIRT2654234	hsa-miR-1909	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001618	Function	Virus receptor activity	IDA	22156524
GO:0001618	Function	Virus receptor activity	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7537495
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	NAS	7511603
GO:0005515	Function	Protein binding	IPI	7634325, 21516116, 22939624, 25416956, 31515488, 32296183, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005635	Component	Nuclear envelope	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	7511603
GO:0006909	Process	Phagocytosis	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	8108112
GO:0007165	Process	Signal transduction	NAS	7511603
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007399	Process	Nervous system development	IBA
GO:0009986	Component	Cell surface	IDA	7511603
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0021885	Process	Forebrain cell migration	IEA
GO:0021885	Process	Forebrain cell migration	ISS
GO:0030168	Process	Platelet activation	IEA
GO:0030168	Process	Platelet activation	ISS
GO:0032940	Process	Secretion by cell	IEA
GO:0032940	Process	Secretion by cell	ISS
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	ISS
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	ISS
GO:0042698	Process	Ovulation cycle	IEA
GO:0042698	Process	Ovulation cycle	ISS
GO:0043235	Component	Receptor complex	IBA
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043277	Process	Apoptotic cell clearance	ISS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	10627473
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	10627473
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	ISS
GO:0046649	Process	Lymphocyte activation	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0051250	Process	Negative regulation of lymphocyte activation	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060068	Process	Vagina development	IEA
GO:0070050	Process	Neuron cellular homeostasis	IEA
GO:0070050	Process	Neuron cellular homeostasis	ISS
GO:0070527	Process	Platelet aggregation	IBA
GO:0070527	Process	Platelet aggregation	IEA
GO:0070527	Process	Platelet aggregation	ISS
GO:1903902	Process	Positive regulation of viral life cycle	IMP	22673088

Other IDs

• MIM: 600341
• HGNC: 12446
• e!Ensembl: ENSG00000092445

Protein

• UniProt ID: Q06418
• Protein name: Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF)
• Protein function: Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including TULP1 or GAS6. Regulates many physiological processes including cell survival, migration and differentiatio
• PDB: 1RHF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	44 → 135	Immunoglobulin I-set domain	Domain
  PF00041	fn3	226 → 310	Fibronectin type III domain	Domain
  PF00041	fn3	324 → 406	Fibronectin type III domain	Domain
  PF07714	PK_Tyr_Ser-Thr	518 → 786	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Abundant in the brain and lower levels in other tissues.
• Sequence:

  MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPV
  KLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVE
  DGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKI
  GGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSN
  ASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRC
  ANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKL
  SWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ
  GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAA
  RSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE
  DGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPM
  VILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARN
  CMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGV
  TMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFT
  CLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV
  GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC

• Sequence length: 890

Pathways

KEGG:

Virion - Flavivirus and Alphavirus
Efferocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
46,XX disorder of sex development	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM INFECTIOUS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	Pubtator	40415137	Associate	★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15674345		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30082152		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	30082152		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30852796		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23632195, 30508140		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32964059, 35951003	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24659691, 30082152		★☆☆☆☆ Found in Text Mining only
Atresia of vagina	Atresia Of Vagina	BEFREE	18393392		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23071254, 25881761, 30729671		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30765874		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24982338		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	17622530		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30765874		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10391562		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20664904		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	40594558	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25428221		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23872063		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27132510, 30793766		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27486820, 28727830, 30226533		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30226533, 33779485, 37116196, 37296477	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11575843, 15934046, 18000365, 21350750, 22782586, 9090389		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	21347448	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28668213	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28668213	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28668213, 30024615, 30429374		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29751371		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36965901	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23418513	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	17243162		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	17243162		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30429374		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	29382817		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	30269813		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29634284		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29634284	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29382817		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	31765735		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31346082		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23872063		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	23354874, 29024938		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	23354874, 29024938		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29024938	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25428221, 9090389		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23982172, 30340900		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	23354874, 29024938		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	18160213		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26573872, 28833396, 31831556		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31831556		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10391562, 18283315		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31346082		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17622530		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	31346082		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	31346082		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	12580372		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24982338, 30501104		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30244621, 31765735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23637920		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30765874		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15934046, 25568918, 28272423, 28526769, 29434888, 30501104, 30714403, 31075180, 31766614, 31775787, 9090389		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27132510, 30793766		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19805117, 29274473		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29274473	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	39179860	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11468178	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25102945		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21347448, 30208252		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21347448	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	27630207		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34165177	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12174360, 23318455, 26573872, 27132510, 27486820, 29708510, 30501104, 30765874, 31765735, 31766614, 31831556, 9844601		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30346880		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	36372373	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30244621, 31765735		★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	17044870		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30729671		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30948610		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	9844601		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23637920		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	29634284	Associate	★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	30429374		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22782586		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30335822		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29024938		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29751371		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36407322	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	27630207		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35955805	Associate	★☆☆☆☆ Found in Text Mining only