Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7296
Gene name	Thioredoxin reductase 1
Gene symbol	TXNRD1
Synonyms (NCBI Gene)	GRIM-12TRTR1TRXR1TXNRTXNR1
Chromosome	12
Chromosome location	12q23.3
Summary	The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing fla

393

Show/Hide all (393)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001489	hsa-miR-155-5p	pSILAC	18668040
MIRT001489	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT021121	hsa-miR-186-5p	Sequencing	20371350
MIRT025447	hsa-miR-34a-5p	Proteomics	21566225
MIRT029399	hsa-miR-26b-5p	Microarray	19088304
MIRT051614	hsa-let-7e-5p	CLASH	23622248
MIRT041077	hsa-miR-504-5p	CLASH	23622248
MIRT697912	hsa-miR-6768-5p	HITS-CLIP	23313552
MIRT565125	hsa-miR-1323	HITS-CLIP	23313552
MIRT565124	hsa-miR-548o-3p	HITS-CLIP	23313552
MIRT697910	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT697911	hsa-miR-219b-5p	HITS-CLIP	23313552
MIRT697909	hsa-miR-124-5p	HITS-CLIP	23313552
MIRT697908	hsa-miR-4672	HITS-CLIP	23313552
MIRT565127	hsa-miR-421	PAR-CLIP	20371350
MIRT565126	hsa-miR-4272	PAR-CLIP	20371350
MIRT565125	hsa-miR-1323	PAR-CLIP	20371350
MIRT565124	hsa-miR-548o-3p	PAR-CLIP	20371350
MIRT565123	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT565122	hsa-miR-1206	PAR-CLIP	20371350
MIRT565121	hsa-miR-6853-3p	PAR-CLIP	20371350
MIRT565120	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT565119	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT565118	hsa-miR-1298-5p	PAR-CLIP	20371350
MIRT464905	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT464904	hsa-miR-1257	PAR-CLIP	23592263
MIRT464903	hsa-miR-5587-5p	PAR-CLIP	23592263
MIRT464902	hsa-miR-3611	PAR-CLIP	23592263
MIRT697912	hsa-miR-6768-5p	HITS-CLIP	23313552
MIRT565125	hsa-miR-1323	HITS-CLIP	23313552
MIRT565124	hsa-miR-548o-3p	HITS-CLIP	23313552
MIRT697910	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT697911	hsa-miR-219b-5p	HITS-CLIP	23313552
MIRT697909	hsa-miR-124-5p	HITS-CLIP	23313552
MIRT697908	hsa-miR-4672	HITS-CLIP	23313552
MIRT565127	hsa-miR-421	PAR-CLIP	20371350
MIRT565126	hsa-miR-4272	PAR-CLIP	20371350
MIRT565125	hsa-miR-1323	PAR-CLIP	20371350
MIRT565124	hsa-miR-548o-3p	PAR-CLIP	20371350
MIRT565123	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT565122	hsa-miR-1206	PAR-CLIP	20371350
MIRT565121	hsa-miR-6853-3p	PAR-CLIP	20371350
MIRT565120	hsa-miR-7159-5p	PAR-CLIP	20371350
MIRT565119	hsa-miR-505-3p	PAR-CLIP	20371350
MIRT565118	hsa-miR-1298-5p	PAR-CLIP	20371350
MIRT464905	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT464904	hsa-miR-1257	PAR-CLIP	23592263
MIRT464903	hsa-miR-5587-5p	PAR-CLIP	23592263
MIRT464902	hsa-miR-3611	PAR-CLIP	23592263
MIRT1465502	hsa-miR-1207-5p	CLIP-seq
MIRT1465503	hsa-miR-1245b-5p	CLIP-seq
MIRT1465504	hsa-miR-1275	CLIP-seq
MIRT1465505	hsa-miR-1295	CLIP-seq
MIRT1465506	hsa-miR-132	CLIP-seq
MIRT1465507	hsa-miR-146b-3p	CLIP-seq
MIRT1465508	hsa-miR-148a	CLIP-seq
MIRT1465509	hsa-miR-148b	CLIP-seq
MIRT1465510	hsa-miR-152	CLIP-seq
MIRT1465511	hsa-miR-1827	CLIP-seq
MIRT1465512	hsa-miR-186	CLIP-seq
MIRT1465513	hsa-miR-190	CLIP-seq
MIRT1465514	hsa-miR-190b	CLIP-seq
MIRT1465515	hsa-miR-194	CLIP-seq
MIRT1465516	hsa-miR-205	CLIP-seq
MIRT1465517	hsa-miR-2052	CLIP-seq
MIRT1465518	hsa-miR-212	CLIP-seq
MIRT1465519	hsa-miR-23a	CLIP-seq
MIRT1465520	hsa-miR-23b	CLIP-seq
MIRT1465521	hsa-miR-23c	CLIP-seq
MIRT1465522	hsa-miR-2964a-5p	CLIP-seq
MIRT1465523	hsa-miR-3123	CLIP-seq
MIRT1465524	hsa-miR-3133	CLIP-seq
MIRT1465525	hsa-miR-3142	CLIP-seq
MIRT1465526	hsa-miR-3151	CLIP-seq
MIRT1465527	hsa-miR-3191	CLIP-seq
MIRT1465528	hsa-miR-3614-5p	CLIP-seq
MIRT1465529	hsa-miR-3646	CLIP-seq
MIRT1465530	hsa-miR-3647-3p	CLIP-seq
MIRT1465531	hsa-miR-3676	CLIP-seq
MIRT1465532	hsa-miR-3684	CLIP-seq
MIRT1465533	hsa-miR-374c	CLIP-seq
MIRT1465534	hsa-miR-3927	CLIP-seq
MIRT1465535	hsa-miR-3942-3p	CLIP-seq
MIRT1465536	hsa-miR-4251	CLIP-seq
MIRT1465537	hsa-miR-4265	CLIP-seq
MIRT1465538	hsa-miR-4283	CLIP-seq
MIRT1465539	hsa-miR-4296	CLIP-seq
MIRT1465540	hsa-miR-4311	CLIP-seq
MIRT1465541	hsa-miR-4322	CLIP-seq
MIRT1465542	hsa-miR-4436b-5p	CLIP-seq
MIRT1465543	hsa-miR-4447	CLIP-seq
MIRT1465544	hsa-miR-4450	CLIP-seq
MIRT1465545	hsa-miR-4451	CLIP-seq
MIRT1465546	hsa-miR-4459	CLIP-seq
MIRT1465547	hsa-miR-4468	CLIP-seq
MIRT1465548	hsa-miR-4472	CLIP-seq
MIRT1465549	hsa-miR-4511	CLIP-seq
MIRT1465550	hsa-miR-4525	CLIP-seq
MIRT1465551	hsa-miR-455-3p	CLIP-seq
MIRT1465552	hsa-miR-4649-3p	CLIP-seq
MIRT1465553	hsa-miR-4665-5p	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT1465555	hsa-miR-4688	CLIP-seq
MIRT1465556	hsa-miR-4690-5p	CLIP-seq
MIRT1465557	hsa-miR-4695-3p	CLIP-seq
MIRT1465558	hsa-miR-4695-5p	CLIP-seq
MIRT1465559	hsa-miR-4698	CLIP-seq
MIRT1465560	hsa-miR-4699-5p	CLIP-seq
MIRT1465561	hsa-miR-4722-5p	CLIP-seq
MIRT1465562	hsa-miR-4723-5p	CLIP-seq
MIRT1465563	hsa-miR-4736	CLIP-seq
MIRT1465564	hsa-miR-4744	CLIP-seq
MIRT1465565	hsa-miR-4763-3p	CLIP-seq
MIRT1465566	hsa-miR-4772-3p	CLIP-seq
MIRT1465567	hsa-miR-4773	CLIP-seq
MIRT1465568	hsa-miR-4789-3p	CLIP-seq
MIRT1465569	hsa-miR-4802-3p	CLIP-seq
MIRT1465570	hsa-miR-491-5p	CLIP-seq
MIRT1465571	hsa-miR-495	CLIP-seq
MIRT1465572	hsa-miR-500a	CLIP-seq
MIRT1465573	hsa-miR-512-3p	CLIP-seq
MIRT1465574	hsa-miR-518a-5p	CLIP-seq
MIRT1465575	hsa-miR-527	CLIP-seq
MIRT1465576	hsa-miR-539	CLIP-seq
MIRT1465577	hsa-miR-543	CLIP-seq
MIRT1465578	hsa-miR-548aa	CLIP-seq
MIRT1465579	hsa-miR-548o	CLIP-seq
MIRT1465580	hsa-miR-548u	CLIP-seq
MIRT1465581	hsa-miR-552	CLIP-seq
MIRT1465582	hsa-miR-587	CLIP-seq
MIRT1465583	hsa-miR-625	CLIP-seq
MIRT1465584	hsa-miR-634	CLIP-seq
MIRT1465585	hsa-miR-655	CLIP-seq
MIRT1465586	hsa-miR-891b	CLIP-seq
MIRT1465513	hsa-miR-190	CLIP-seq
MIRT1465514	hsa-miR-190b	CLIP-seq
MIRT1465587	hsa-miR-3140-3p	CLIP-seq
MIRT1465588	hsa-miR-4520a-3p	CLIP-seq
MIRT1465589	hsa-miR-4520b-3p	CLIP-seq
MIRT1465590	hsa-miR-4529-3p	CLIP-seq
MIRT1465564	hsa-miR-4744	CLIP-seq
MIRT1465580	hsa-miR-548u	CLIP-seq
MIRT1555294	hsa-miR-3974	CLIP-seq
MIRT1555295	hsa-miR-4457	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT1465566	hsa-miR-4772-3p	CLIP-seq
MIRT1555296	hsa-miR-548a-3p	CLIP-seq
MIRT1555297	hsa-miR-548e	CLIP-seq
MIRT1555298	hsa-miR-548f	CLIP-seq
MIRT1557243	hsa-miR-3121-3p	CLIP-seq
MIRT1465587	hsa-miR-3140-3p	CLIP-seq
MIRT1557244	hsa-miR-3685	CLIP-seq
MIRT1557245	hsa-miR-384	CLIP-seq
MIRT1465588	hsa-miR-4520a-3p	CLIP-seq
MIRT1465589	hsa-miR-4520b-3p	CLIP-seq
MIRT1465590	hsa-miR-4529-3p	CLIP-seq
MIRT1557246	hsa-miR-548c-3p	CLIP-seq
MIRT1465529	hsa-miR-3646	CLIP-seq
MIRT2139947	hsa-miR-4645-5p	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT2139948	hsa-miR-4673	CLIP-seq
MIRT2139949	hsa-miR-4755-3p	CLIP-seq
MIRT1465572	hsa-miR-500a	CLIP-seq
MIRT1465577	hsa-miR-543	CLIP-seq
MIRT2360610	hsa-miR-103b	CLIP-seq
MIRT2360611	hsa-miR-1207-3p	CLIP-seq
MIRT2360612	hsa-miR-125a-5p	CLIP-seq
MIRT2360613	hsa-miR-125b	CLIP-seq
MIRT1465517	hsa-miR-2052	CLIP-seq
MIRT2360614	hsa-miR-2117	CLIP-seq
MIRT1465519	hsa-miR-23a	CLIP-seq
MIRT1465520	hsa-miR-23b	CLIP-seq
MIRT1465521	hsa-miR-23c	CLIP-seq
MIRT2360615	hsa-miR-3124-3p	CLIP-seq
MIRT2360616	hsa-miR-3136-3p	CLIP-seq
MIRT1465526	hsa-miR-3151	CLIP-seq
MIRT1465532	hsa-miR-3684	CLIP-seq
MIRT2360617	hsa-miR-376c	CLIP-seq
MIRT1465534	hsa-miR-3927	CLIP-seq
MIRT1465536	hsa-miR-4251	CLIP-seq
MIRT2360618	hsa-miR-4277	CLIP-seq
MIRT2360619	hsa-miR-4319	CLIP-seq
MIRT1465543	hsa-miR-4447	CLIP-seq
MIRT1465545	hsa-miR-4451	CLIP-seq
MIRT1465548	hsa-miR-4472	CLIP-seq
MIRT2360620	hsa-miR-4514	CLIP-seq
MIRT2360621	hsa-miR-4532	CLIP-seq
MIRT2139947	hsa-miR-4645-5p	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT2139948	hsa-miR-4673	CLIP-seq
MIRT2360622	hsa-miR-4692	CLIP-seq
MIRT1465557	hsa-miR-4695-3p	CLIP-seq
MIRT2360623	hsa-miR-4732-3p	CLIP-seq
MIRT2360624	hsa-miR-4753-3p	CLIP-seq
MIRT2139949	hsa-miR-4755-3p	CLIP-seq
MIRT1465570	hsa-miR-491-5p	CLIP-seq
MIRT1465572	hsa-miR-500a	CLIP-seq
MIRT1465574	hsa-miR-518a-5p	CLIP-seq
MIRT1465575	hsa-miR-527	CLIP-seq
MIRT1465576	hsa-miR-539	CLIP-seq
MIRT2360625	hsa-miR-544b	CLIP-seq
MIRT1465581	hsa-miR-552	CLIP-seq
MIRT1465584	hsa-miR-634	CLIP-seq
MIRT2360626	hsa-miR-663b	CLIP-seq
MIRT2360627	hsa-miR-670	CLIP-seq
MIRT1465586	hsa-miR-891b	CLIP-seq
MIRT1465566	hsa-miR-4772-3p	CLIP-seq
MIRT1465586	hsa-miR-891b	CLIP-seq
MIRT2396547	hsa-miR-1205	CLIP-seq
MIRT2360611	hsa-miR-1207-3p	CLIP-seq
MIRT2396548	hsa-miR-1286	CLIP-seq
MIRT1465506	hsa-miR-132	CLIP-seq
MIRT2360614	hsa-miR-2117	CLIP-seq
MIRT1465518	hsa-miR-212	CLIP-seq
MIRT2360618	hsa-miR-4277	CLIP-seq
MIRT2396549	hsa-miR-4436a	CLIP-seq
MIRT1465551	hsa-miR-455-3p	CLIP-seq
MIRT1465561	hsa-miR-4722-5p	CLIP-seq
MIRT2360624	hsa-miR-4753-3p	CLIP-seq
MIRT1465567	hsa-miR-4773	CLIP-seq
MIRT1465530	hsa-miR-3647-3p	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT1465572	hsa-miR-500a	CLIP-seq
MIRT2434410	hsa-miR-549	CLIP-seq
MIRT2434411	hsa-miR-203	CLIP-seq
MIRT1465530	hsa-miR-3647-3p	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT1465572	hsa-miR-500a	CLIP-seq
MIRT2434410	hsa-miR-549	CLIP-seq
MIRT1465511	hsa-miR-1827	CLIP-seq
MIRT2441573	hsa-miR-4316	CLIP-seq
MIRT2441574	hsa-miR-3672	CLIP-seq
MIRT2654181	hsa-miR-105	CLIP-seq
MIRT2654182	hsa-miR-124	CLIP-seq
MIRT2654183	hsa-miR-1297	CLIP-seq
MIRT2654184	hsa-miR-1298	CLIP-seq
MIRT2654185	hsa-miR-140-3p	CLIP-seq
MIRT1465507	hsa-miR-146b-3p	CLIP-seq
MIRT1465511	hsa-miR-1827	CLIP-seq
MIRT2654186	hsa-miR-188-5p	CLIP-seq
MIRT2434411	hsa-miR-203	CLIP-seq
MIRT2654187	hsa-miR-204	CLIP-seq
MIRT2654188	hsa-miR-211	CLIP-seq
MIRT2654189	hsa-miR-2276	CLIP-seq
MIRT2654190	hsa-miR-26a	CLIP-seq
MIRT2654191	hsa-miR-26b	CLIP-seq
MIRT2654192	hsa-miR-302f	CLIP-seq
MIRT2654193	hsa-miR-3164	CLIP-seq
MIRT2654194	hsa-miR-3173-5p	CLIP-seq
MIRT2654195	hsa-miR-324-5p	CLIP-seq
MIRT2654196	hsa-miR-330-3p	CLIP-seq
MIRT1465528	hsa-miR-3614-5p	CLIP-seq
MIRT1465529	hsa-miR-3646	CLIP-seq
MIRT2654197	hsa-miR-3652	CLIP-seq
MIRT2654198	hsa-miR-3667-3p	CLIP-seq
MIRT2441574	hsa-miR-3672	CLIP-seq
MIRT2654199	hsa-miR-3692	CLIP-seq
MIRT2654200	hsa-miR-369-3p	CLIP-seq
MIRT2654201	hsa-miR-374a	CLIP-seq
MIRT2654202	hsa-miR-374b	CLIP-seq
MIRT1465533	hsa-miR-374c	CLIP-seq
MIRT2654203	hsa-miR-3926	CLIP-seq
MIRT2654204	hsa-miR-3941	CLIP-seq
MIRT1555294	hsa-miR-3974	CLIP-seq
MIRT2654205	hsa-miR-4299	CLIP-seq
MIRT2654206	hsa-miR-4422	CLIP-seq
MIRT2654207	hsa-miR-4430	CLIP-seq
MIRT2654208	hsa-miR-4446-5p	CLIP-seq
MIRT1555295	hsa-miR-4457	CLIP-seq
MIRT2654209	hsa-miR-4463	CLIP-seq
MIRT2654210	hsa-miR-4465	CLIP-seq
MIRT2654211	hsa-miR-4480	CLIP-seq
MIRT2654212	hsa-miR-4505	CLIP-seq
MIRT2654213	hsa-miR-4645-3p	CLIP-seq
MIRT2139947	hsa-miR-4645-5p	CLIP-seq
MIRT1465552	hsa-miR-4649-3p	CLIP-seq
MIRT2654214	hsa-miR-466	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT2139948	hsa-miR-4673	CLIP-seq
MIRT2654215	hsa-miR-4710	CLIP-seq
MIRT2654216	hsa-miR-4717-3p	CLIP-seq
MIRT2654217	hsa-miR-4722-3p	CLIP-seq
MIRT2654218	hsa-miR-4742-5p	CLIP-seq
MIRT2139949	hsa-miR-4755-3p	CLIP-seq
MIRT2654219	hsa-miR-4755-5p	CLIP-seq
MIRT1465566	hsa-miR-4772-3p	CLIP-seq
MIRT1465568	hsa-miR-4789-3p	CLIP-seq
MIRT2654220	hsa-miR-4792	CLIP-seq
MIRT2654221	hsa-miR-487a	CLIP-seq
MIRT2654222	hsa-miR-490-5p	CLIP-seq
MIRT1465571	hsa-miR-495	CLIP-seq
MIRT2654223	hsa-miR-506	CLIP-seq
MIRT2654224	hsa-miR-544	CLIP-seq
MIRT1555296	hsa-miR-548a-3p	CLIP-seq
MIRT1465578	hsa-miR-548aa	CLIP-seq
MIRT1555297	hsa-miR-548e	CLIP-seq
MIRT1555298	hsa-miR-548f	CLIP-seq
MIRT1465579	hsa-miR-548o	CLIP-seq
MIRT2654225	hsa-miR-548s	CLIP-seq
MIRT2434410	hsa-miR-549	CLIP-seq
MIRT2654226	hsa-miR-562	CLIP-seq
MIRT2654227	hsa-miR-580	CLIP-seq
MIRT2654228	hsa-miR-617	CLIP-seq
MIRT2654229	hsa-miR-623	CLIP-seq
MIRT1465585	hsa-miR-655	CLIP-seq
MIRT2654230	hsa-miR-874	CLIP-seq
MIRT2654231	hsa-miR-875-5p	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT2654181	hsa-miR-105	CLIP-seq
MIRT2694550	hsa-miR-1224-5p	CLIP-seq
MIRT2654182	hsa-miR-124	CLIP-seq
MIRT2694551	hsa-miR-1273f	CLIP-seq
MIRT2654183	hsa-miR-1297	CLIP-seq
MIRT2654184	hsa-miR-1298	CLIP-seq
MIRT2654185	hsa-miR-140-3p	CLIP-seq
MIRT2694552	hsa-miR-143	CLIP-seq
MIRT1465507	hsa-miR-146b-3p	CLIP-seq
MIRT1465511	hsa-miR-1827	CLIP-seq
MIRT2654186	hsa-miR-188-5p	CLIP-seq
MIRT2434411	hsa-miR-203	CLIP-seq
MIRT2654187	hsa-miR-204	CLIP-seq
MIRT2654188	hsa-miR-211	CLIP-seq
MIRT2654189	hsa-miR-2276	CLIP-seq
MIRT2654190	hsa-miR-26a	CLIP-seq
MIRT2654191	hsa-miR-26b	CLIP-seq
MIRT2654192	hsa-miR-302f	CLIP-seq
MIRT2654193	hsa-miR-3164	CLIP-seq
MIRT2654194	hsa-miR-3173-5p	CLIP-seq
MIRT2654195	hsa-miR-324-5p	CLIP-seq
MIRT2654196	hsa-miR-330-3p	CLIP-seq
MIRT1465528	hsa-miR-3614-5p	CLIP-seq
MIRT2654197	hsa-miR-3652	CLIP-seq
MIRT2654198	hsa-miR-3667-3p	CLIP-seq
MIRT2441574	hsa-miR-3672	CLIP-seq
MIRT2654199	hsa-miR-3692	CLIP-seq
MIRT2654200	hsa-miR-369-3p	CLIP-seq
MIRT2654201	hsa-miR-374a	CLIP-seq
MIRT2654202	hsa-miR-374b	CLIP-seq
MIRT1465533	hsa-miR-374c	CLIP-seq
MIRT2654203	hsa-miR-3926	CLIP-seq
MIRT2654204	hsa-miR-3941	CLIP-seq
MIRT1555294	hsa-miR-3974	CLIP-seq
MIRT2654205	hsa-miR-4299	CLIP-seq
MIRT2441573	hsa-miR-4316	CLIP-seq
MIRT2654206	hsa-miR-4422	CLIP-seq
MIRT2654207	hsa-miR-4430	CLIP-seq
MIRT2654208	hsa-miR-4446-5p	CLIP-seq
MIRT1555295	hsa-miR-4457	CLIP-seq
MIRT2654209	hsa-miR-4463	CLIP-seq
MIRT2654210	hsa-miR-4465	CLIP-seq
MIRT2654211	hsa-miR-4480	CLIP-seq
MIRT2654212	hsa-miR-4505	CLIP-seq
MIRT2654213	hsa-miR-4645-3p	CLIP-seq
MIRT2139947	hsa-miR-4645-5p	CLIP-seq
MIRT1465552	hsa-miR-4649-3p	CLIP-seq
MIRT2654214	hsa-miR-466	CLIP-seq
MIRT1465554	hsa-miR-4668-3p	CLIP-seq
MIRT2139948	hsa-miR-4673	CLIP-seq
MIRT2694553	hsa-miR-4708-5p	CLIP-seq
MIRT2654215	hsa-miR-4710	CLIP-seq
MIRT2654216	hsa-miR-4717-3p	CLIP-seq
MIRT2654217	hsa-miR-4722-3p	CLIP-seq
MIRT2654218	hsa-miR-4742-5p	CLIP-seq
MIRT2694554	hsa-miR-4751	CLIP-seq
MIRT2139949	hsa-miR-4755-3p	CLIP-seq
MIRT2654219	hsa-miR-4755-5p	CLIP-seq
MIRT2694555	hsa-miR-4770	CLIP-seq
MIRT1465566	hsa-miR-4772-3p	CLIP-seq
MIRT1465568	hsa-miR-4789-3p	CLIP-seq
MIRT2654220	hsa-miR-4792	CLIP-seq
MIRT2654221	hsa-miR-487a	CLIP-seq
MIRT2654222	hsa-miR-490-5p	CLIP-seq
MIRT1465571	hsa-miR-495	CLIP-seq
MIRT1465572	hsa-miR-500a	CLIP-seq
MIRT2654223	hsa-miR-506	CLIP-seq
MIRT2654224	hsa-miR-544	CLIP-seq
MIRT1555296	hsa-miR-548a-3p	CLIP-seq
MIRT1465578	hsa-miR-548aa	CLIP-seq
MIRT1555297	hsa-miR-548e	CLIP-seq
MIRT1555298	hsa-miR-548f	CLIP-seq
MIRT1465579	hsa-miR-548o	CLIP-seq
MIRT2654225	hsa-miR-548s	CLIP-seq
MIRT2434410	hsa-miR-549	CLIP-seq
MIRT2654226	hsa-miR-562	CLIP-seq
MIRT2654227	hsa-miR-580	CLIP-seq
MIRT2654228	hsa-miR-617	CLIP-seq
MIRT2654229	hsa-miR-623	CLIP-seq
MIRT1465585	hsa-miR-655	CLIP-seq
MIRT2654230	hsa-miR-874	CLIP-seq
MIRT2654231	hsa-miR-875-5p	CLIP-seq
MIRT2441574	hsa-miR-3672	CLIP-seq
MIRT2654209	hsa-miR-4463	CLIP-seq
MIRT2654213	hsa-miR-4645-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU2F1	Unknown	11375392

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0001707	Process	Mesoderm formation	IEA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IBA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IDA	8577704
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IEA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	TAS	9671710
GO:0005515	Function	Protein binding	IPI	15199063, 19820694, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	NAS	8921404
GO:0007369	Process	Gastrulation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016668	Function	Oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor	IEA
GO:0042802	Function	Identical protein binding	IDA	8577704
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0050137	Function	NADPH peroxidase activity	IDA	10849437
GO:0050137	Function	NADPH peroxidase activity	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0071949	Function	FAD binding	IDA	8577704
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
601112	12437	ENSG00000198431

Q16881

Protein name

Thioredoxin reductase 1, cytoplasmic (TR) (EC 1.8.1.9) (Gene associated with retinoic and interferon-induced mortality 12 protein) (GRIM-12) (Gene associated with retinoic and IFN-induced mortality 12 protein) (KM-102-derived reductase-like factor) (Perox

Protein function

Reduces disulfideprotein thioredoxin (Trx) to its dithiol-containing form (PubMed:8577704). Homodimeric flavoprotein involved in the regulation of cellular redox reactions, growth and differentiation. Contains a selenocysteine residue at the C-t

PDB

2CFY , 2J3N , 2ZZ0 , 2ZZB , 2ZZC , 3QFA , 3QFB , 7X1R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00462	Glutaredoxin	68 → 130	Glutaredoxin	Domain
PF07992	Pyr_redox_2	163 → 500	Pyridine nucleotide-disulphide oxidoreductase	Domain
PF02852	Pyr_redox_dim	520 → 633	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. {ECO:0000269|PubMed:18042542}.; TISSUE SPECIFICITY: [Isof

Sequence

MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG

Sequence length

649

Interactions

View interactions

	KEGG		Reactome
	Selenocompound metabolism Pathways in cancer Hepatocellular carcinoma		PPARA activates gene expression Detoxification of Reactive Oxygen Species Interconversion of nucleotide di- and triphosphates Metabolism of ingested MeSeO2H into MeSeH Uptake and function of diphtheria toxin TP53 Regulates Metabolic Genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, LEWIS LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (136)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
11-Beta-hydroxylase deficiency	11-beta-hydroxylase deficiency	BEFREE	29543924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24583460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29383158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36928034, 37621137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	18996185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	18996185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28009916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28009916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36754152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	19499324		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29897571, 31446057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15740016, 20584310, 24278290, 25454514, 26760912, 28431312, 31430859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20584310, 23216744, 24278290, 29162888, 36335879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26760912, 31430859	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30024305, 30805084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	31824475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28536696, 33188160, 36378050, 37181805, 38025761, 38097352, 38308689, 40465781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18405881, 19766715, 20920480, 23824739, 28454363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31568004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19327385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28450497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	31601260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	31601260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	13679440, 20098717, 22615972, 29037867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31811910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18483336		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20098717, 22615972, 31027226, 32596335	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital adrenal hyperplasia due to 11-Beta-hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	29543924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	16436457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29805604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29592844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36928034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35669396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18229449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30253414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32679649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	19499324		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	39849427	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	19499324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	28232204, 29709707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	19499324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	21262347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34999996, 35703190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	30457989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	34722766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26919834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28345125	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36555352, 37834393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28338004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	20920480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	35322580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28413470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26743692, 33493155	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	16436457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20483575	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36814575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18229449	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	31248988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30909158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	29749372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28536696, 30561826, 30619751, 31097586, 31367013, 31384178, 31680962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30619751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20920480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30212802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20920480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31389073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18422776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17316382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15740016, 20584310, 24278290, 25454514, 26760912, 28431312, 31430859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22222370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18405881, 20920480, 23824739, 28454363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23143801, 26771192, 30410640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29371830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	13679440, 19272412, 19327385, 19838062, 20609915, 20864247, 20920480, 24583460, 27084455, 28000803, 28338004, 28536696, 29054416, 29117711, 29383158 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	13679440, 20098717, 22615972, 29037867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23216744		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26029997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37892173	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	25592259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	17316382		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20920480, 36358916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	29590638, 31248988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25945832, 26743692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25945832, 26743692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31389073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34799616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	17316382, 19000754, 19818074, 19838062, 20160040, 20584310, 22222370, 22391025, 27845352, 28338004, 29037867, 30561826, 31097586, 31113439, 31325708		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18996185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26464515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31400708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37269647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27845352, 29383158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21593104, 34684477	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29162888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	31248988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	36358916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33455417	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19781675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31920141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	9657524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29910195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	18483336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30983487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29852184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23143801, 26771192, 30410640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23133653, 34125740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33493155, 35441963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22615972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30853960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	24024160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30024305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	24024160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18632643, 28300829, 30853960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren-Larsson Syndrome	Sjogren-Larsson Syndrome	BEFREE	16436457, 31697031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	16436457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	29211771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21206984, 29383158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22441776, 29416738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29371830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29371830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30609207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16175400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TXNRD1 (thioredoxin reductase 1)