Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	729533
Gene name	Family with sequence similarity 72 member A
Gene symbol	FAM72A
Synonyms (NCBI Gene)	LMPIPUgenep17
Chromosome	1
Chromosome location	1q32.1

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038312	hsa-miR-130b-5p	CLASH	23622248
MIRT037238	hsa-miR-877-5p	CLASH	23622248
MIRT986838	hsa-let-7a	CLIP-seq
MIRT986839	hsa-let-7b	CLIP-seq
MIRT986840	hsa-let-7c	CLIP-seq
MIRT986841	hsa-let-7d	CLIP-seq
MIRT986842	hsa-let-7e	CLIP-seq
MIRT986843	hsa-let-7f	CLIP-seq
MIRT986844	hsa-let-7g	CLIP-seq
MIRT986845	hsa-let-7i	CLIP-seq
MIRT986846	hsa-miR-1	CLIP-seq
MIRT986847	hsa-miR-105	CLIP-seq
MIRT986848	hsa-miR-1225-5p	CLIP-seq
MIRT986849	hsa-miR-1245b-5p	CLIP-seq
MIRT986850	hsa-miR-1303	CLIP-seq
MIRT986851	hsa-miR-135a	CLIP-seq
MIRT986852	hsa-miR-135b	CLIP-seq
MIRT986853	hsa-miR-202	CLIP-seq
MIRT986854	hsa-miR-203	CLIP-seq
MIRT986855	hsa-miR-206	CLIP-seq
MIRT986856	hsa-miR-3065-5p	CLIP-seq
MIRT986857	hsa-miR-30a	CLIP-seq
MIRT986858	hsa-miR-30b	CLIP-seq
MIRT986859	hsa-miR-30c	CLIP-seq
MIRT986860	hsa-miR-30d	CLIP-seq
MIRT986861	hsa-miR-30e	CLIP-seq
MIRT986862	hsa-miR-3119	CLIP-seq
MIRT986863	hsa-miR-3125	CLIP-seq
MIRT986864	hsa-miR-3128	CLIP-seq
MIRT986865	hsa-miR-3129-3p	CLIP-seq
MIRT986866	hsa-miR-3142	CLIP-seq
MIRT986867	hsa-miR-3143	CLIP-seq
MIRT986868	hsa-miR-3189-5p	CLIP-seq
MIRT986869	hsa-miR-338-5p	CLIP-seq
MIRT986870	hsa-miR-3613-3p	CLIP-seq
MIRT986871	hsa-miR-365	CLIP-seq
MIRT986872	hsa-miR-369-3p	CLIP-seq
MIRT986873	hsa-miR-374a	CLIP-seq
MIRT986874	hsa-miR-374b	CLIP-seq
MIRT986875	hsa-miR-374c	CLIP-seq
MIRT986876	hsa-miR-3916	CLIP-seq
MIRT986877	hsa-miR-4264	CLIP-seq
MIRT986878	hsa-miR-4420	CLIP-seq
MIRT986879	hsa-miR-4458	CLIP-seq
MIRT986880	hsa-miR-4464	CLIP-seq
MIRT986881	hsa-miR-4495	CLIP-seq
MIRT986882	hsa-miR-4500	CLIP-seq
MIRT986883	hsa-miR-4666-3p	CLIP-seq
MIRT986884	hsa-miR-4699-3p	CLIP-seq
MIRT986885	hsa-miR-4705	CLIP-seq
MIRT986886	hsa-miR-4748	CLIP-seq
MIRT986887	hsa-miR-4758-3p	CLIP-seq
MIRT986888	hsa-miR-520d-5p	CLIP-seq
MIRT986889	hsa-miR-524-5p	CLIP-seq
MIRT986890	hsa-miR-543	CLIP-seq
MIRT986891	hsa-miR-548aa	CLIP-seq
MIRT986892	hsa-miR-548ae	CLIP-seq
MIRT986893	hsa-miR-548aj	CLIP-seq
MIRT986894	hsa-miR-548am	CLIP-seq
MIRT986895	hsa-miR-548x	CLIP-seq
MIRT986896	hsa-miR-563	CLIP-seq
MIRT986897	hsa-miR-590-3p	CLIP-seq
MIRT986898	hsa-miR-613	CLIP-seq
MIRT986899	hsa-miR-622	CLIP-seq
MIRT986900	hsa-miR-655	CLIP-seq
MIRT986901	hsa-miR-873	CLIP-seq
MIRT986902	hsa-miR-877	CLIP-seq
MIRT986903	hsa-miR-892b	CLIP-seq
MIRT986904	hsa-miR-9	CLIP-seq
MIRT986905	hsa-miR-98	CLIP-seq
MIRT986838	hsa-let-7a	CLIP-seq
MIRT986839	hsa-let-7b	CLIP-seq
MIRT986840	hsa-let-7c	CLIP-seq
MIRT986841	hsa-let-7d	CLIP-seq
MIRT986842	hsa-let-7e	CLIP-seq
MIRT986843	hsa-let-7f	CLIP-seq
MIRT986844	hsa-let-7g	CLIP-seq
MIRT986845	hsa-let-7i	CLIP-seq
MIRT986853	hsa-miR-202	CLIP-seq
MIRT986865	hsa-miR-3129-3p	CLIP-seq
MIRT986873	hsa-miR-374a	CLIP-seq
MIRT986874	hsa-miR-374b	CLIP-seq
MIRT986878	hsa-miR-4420	CLIP-seq
MIRT986879	hsa-miR-4458	CLIP-seq
MIRT986882	hsa-miR-4500	CLIP-seq
MIRT986885	hsa-miR-4705	CLIP-seq
MIRT1992491	hsa-miR-4719	CLIP-seq
MIRT1992492	hsa-miR-4729	CLIP-seq
MIRT1992493	hsa-miR-513b	CLIP-seq
MIRT986891	hsa-miR-548aa	CLIP-seq
MIRT986897	hsa-miR-590-3p	CLIP-seq
MIRT986903	hsa-miR-892b	CLIP-seq
MIRT986905	hsa-miR-98	CLIP-seq
MIRT986838	hsa-let-7a	CLIP-seq
MIRT986839	hsa-let-7b	CLIP-seq
MIRT986840	hsa-let-7c	CLIP-seq
MIRT986841	hsa-let-7d	CLIP-seq
MIRT986842	hsa-let-7e	CLIP-seq
MIRT986843	hsa-let-7f	CLIP-seq
MIRT986844	hsa-let-7g	CLIP-seq
MIRT986845	hsa-let-7i	CLIP-seq
MIRT986853	hsa-miR-202	CLIP-seq
MIRT986865	hsa-miR-3129-3p	CLIP-seq
MIRT986877	hsa-miR-4264	CLIP-seq
MIRT986878	hsa-miR-4420	CLIP-seq
MIRT986879	hsa-miR-4458	CLIP-seq
MIRT986882	hsa-miR-4500	CLIP-seq
MIRT2226453	hsa-miR-4668-3p	CLIP-seq
MIRT986884	hsa-miR-4699-3p	CLIP-seq
MIRT986885	hsa-miR-4705	CLIP-seq
MIRT2226454	hsa-miR-4728-3p	CLIP-seq
MIRT1992492	hsa-miR-4729	CLIP-seq
MIRT986891	hsa-miR-548aa	CLIP-seq
MIRT2226455	hsa-miR-605	CLIP-seq
MIRT986899	hsa-miR-622	CLIP-seq
MIRT986903	hsa-miR-892b	CLIP-seq
MIRT986904	hsa-miR-9	CLIP-seq
MIRT986905	hsa-miR-98	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA

MIM	HGNC	e!Ensembl
614710	24044	ENSG00000196550

Q5TYM5

Protein name

Protein FAM72A (Latent membrane protein 1-induced protein) (LMP1-induced protein) (LMPIP)

Protein function

May play a role in the regulation of cellular reactive oxygen species metabolism. May participate in cell growth regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14976	FAM72	5 → 149	FAM72 protein	Family

Tissue specificity

TISSUE SPECIFICITY: May be up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. Expression is also elevated in other common cancer types, including breast, lung, uterus, and ovary. {ECO:0000269|PubMed:18676834}.

Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGV
NVLLWGNLPEIEESTDEDVLNISAEECIR

Sequence length

149

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	36868233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18676834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30390010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	8573375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18676834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30261551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12010812, 28072889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11973654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19513564, 29907572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21317926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21317926, 23202800, 23900679, 26773045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18676834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28092842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30390010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21185199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18997086, 28241318, 30664207		★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM72A (family with sequence similarity 72 member A)