TXK (TXK tyrosine kinase)

Gene

• Entrez ID: 7294
• Gene name: TXK tyrosine kinase
• Gene symbol: TXK
• Synonyms (NCBI Gene): BTKL, PSCTK5, PTK4, RLK, TKL
• Chromosome: 4
• Chromosome location: 4p12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029543	hsa-miR-26b-5p	Microarray	19088304
MIRT531782	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT531781	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT531780	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT531779	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT531778	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT531777	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT531776	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT531775	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT531774	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT531773	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT531772	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT531771	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT531770	hsa-miR-302e	HITS-CLIP	23313552
MIRT531769	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT531768	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT531767	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT531766	hsa-miR-520b	HITS-CLIP	23313552
MIRT531765	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT531764	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT531763	hsa-miR-520e	HITS-CLIP	23313552
MIRT685558	hsa-miR-6813-3p	HITS-CLIP	23313552
MIRT531761	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT685557	hsa-miR-101-5p	HITS-CLIP	23313552
MIRT685556	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT531759	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT531758	hsa-miR-520h	HITS-CLIP	23313552
MIRT685555	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT685554	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT685553	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685552	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT685551	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT685550	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT685549	hsa-miR-188-3p	HITS-CLIP	23313552
MIRT685548	hsa-miR-1260a	HITS-CLIP	23313552
MIRT685547	hsa-miR-1260b	HITS-CLIP	23313552
MIRT685546	hsa-miR-3156-3p	HITS-CLIP	23313552
MIRT685545	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT531782	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT531781	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT531780	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT531779	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT531778	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT531777	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT531776	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT531775	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT531774	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT531773	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT531772	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT531771	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT531770	hsa-miR-302e	PAR-CLIP	22012620
MIRT531769	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT531768	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT531767	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT531766	hsa-miR-520b	PAR-CLIP	22012620
MIRT531765	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT531764	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT531763	hsa-miR-520e	PAR-CLIP	22012620
MIRT531762	hsa-miR-4438	PAR-CLIP	22012620
MIRT531761	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT531760	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT531759	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT531758	hsa-miR-520h	PAR-CLIP	22012620
MIRT531757	hsa-miR-1234-3p	PAR-CLIP	22012620
MIRT531756	hsa-miR-7107-5p	PAR-CLIP	22012620
MIRT531755	hsa-miR-150-5p	PAR-CLIP	22012620
MIRT531754	hsa-miR-378j	PAR-CLIP	22012620
MIRT531753	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT531752	hsa-miR-6778-3p	PAR-CLIP	22012620
MIRT531751	hsa-miR-3135b	PAR-CLIP	22012620
MIRT531750	hsa-miR-1287-5p	PAR-CLIP	22012620
MIRT531749	hsa-miR-5095	PAR-CLIP	22012620
MIRT531748	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT531747	hsa-miR-6807-5p	PAR-CLIP	22012620
MIRT531746	hsa-miR-619-5p	PAR-CLIP	22012620
MIRT531745	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT531744	hsa-miR-541-5p	PAR-CLIP	22012620
MIRT531743	hsa-miR-3159	PAR-CLIP	22012620
MIRT531742	hsa-miR-382-3p	PAR-CLIP	22012620
MIRT531741	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT531740	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT531739	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT531738	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT531749	hsa-miR-5095	PAR-CLIP	27292025
MIRT531746	hsa-miR-619-5p	PAR-CLIP	27292025
MIRT531760	hsa-miR-6504-3p	PAR-CLIP	27292025
MIRT531752	hsa-miR-6778-3p	PAR-CLIP	27292025
MIRT531748	hsa-miR-7151-3p	PAR-CLIP	27292025
MIRT531782	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT531781	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT531780	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT531779	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT531778	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT531777	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT531776	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT531775	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT531774	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT531773	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT531772	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT531771	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT531770	hsa-miR-302e	HITS-CLIP	23313552
MIRT531769	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT531768	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT531767	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT531766	hsa-miR-520b	HITS-CLIP	23313552
MIRT531765	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT531764	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT531763	hsa-miR-520e	HITS-CLIP	23313552
MIRT685558	hsa-miR-6813-3p	HITS-CLIP	23313552
MIRT531761	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT685557	hsa-miR-101-5p	HITS-CLIP	23313552
MIRT685556	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT531759	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT531758	hsa-miR-520h	HITS-CLIP	23313552
MIRT685555	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT685554	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT685553	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685552	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT685551	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT685550	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT685549	hsa-miR-188-3p	HITS-CLIP	23313552
MIRT685548	hsa-miR-1260a	HITS-CLIP	23313552
MIRT685547	hsa-miR-1260b	HITS-CLIP	23313552
MIRT685546	hsa-miR-3156-3p	HITS-CLIP	23313552
MIRT685545	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT531782	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT531781	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT531780	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT531779	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT531778	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT531777	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT531776	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT531775	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT531774	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT531773	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT531772	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT531771	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT531770	hsa-miR-302e	PAR-CLIP	22012620
MIRT531769	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT531768	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT531767	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT531766	hsa-miR-520b	PAR-CLIP	22012620
MIRT531765	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT531764	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT531763	hsa-miR-520e	PAR-CLIP	22012620
MIRT531762	hsa-miR-4438	PAR-CLIP	22012620
MIRT531761	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT531760	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT531759	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT531758	hsa-miR-520h	PAR-CLIP	22012620
MIRT531757	hsa-miR-1234-3p	PAR-CLIP	22012620
MIRT531756	hsa-miR-7107-5p	PAR-CLIP	22012620
MIRT531755	hsa-miR-150-5p	PAR-CLIP	22012620
MIRT531754	hsa-miR-378j	PAR-CLIP	22012620
MIRT531753	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT531752	hsa-miR-6778-3p	PAR-CLIP	22012620
MIRT531751	hsa-miR-3135b	PAR-CLIP	22012620
MIRT531750	hsa-miR-1287-5p	PAR-CLIP	22012620
MIRT531749	hsa-miR-5095	PAR-CLIP	22012620
MIRT531748	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT531747	hsa-miR-6807-5p	PAR-CLIP	22012620
MIRT531746	hsa-miR-619-5p	PAR-CLIP	22012620
MIRT531745	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT531744	hsa-miR-541-5p	PAR-CLIP	22012620
MIRT531743	hsa-miR-3159	PAR-CLIP	22012620
MIRT531742	hsa-miR-382-3p	PAR-CLIP	22012620
MIRT531741	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT531740	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT531739	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT531738	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT1464614	hsa-miR-3065-5p	CLIP-seq
MIRT1464615	hsa-miR-369-3p	CLIP-seq
MIRT1464616	hsa-miR-374c	CLIP-seq
MIRT1464617	hsa-miR-4643	CLIP-seq
MIRT1464618	hsa-miR-466	CLIP-seq
MIRT1464619	hsa-miR-4729	CLIP-seq
MIRT1464620	hsa-miR-4789-3p	CLIP-seq
MIRT1464621	hsa-miR-606	CLIP-seq
MIRT1464622	hsa-miR-655	CLIP-seq
MIRT2360309	hsa-miR-1264	CLIP-seq
MIRT2360310	hsa-miR-23a	CLIP-seq
MIRT2360311	hsa-miR-23b	CLIP-seq
MIRT2360312	hsa-miR-23c	CLIP-seq
MIRT2360313	hsa-miR-412	CLIP-seq
MIRT2360314	hsa-miR-4778-3p	CLIP-seq
MIRT2360315	hsa-miR-5096	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0002250	Process	Adaptive immune response	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	17177976, 24728074, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10523612, 17177976
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	10523612, 17177976
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	17177976
GO:0010468	Process	Regulation of gene expression	IDA	11859127
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	10523612, 11859127
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11859127
GO:0046777	Process	Protein autophosphorylation	IDA	12081135, 17177976
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0060335	Process	Positive regulation of type II interferon-mediated signaling pathway	IDA	11859127

Other IDs

• MIM: 600058
• HGNC: 12434
• e!Ensembl: ENSG00000074966

Protein

• UniProt ID: P42681
• Protein name: Tyrosine-protein kinase TXK (EC 2.7.10.2) (Protein-tyrosine kinase 4) (Resting lymphocyte kinase)
• Protein function: Non-receptor tyrosine kinase that plays a redundant role with ITK in regulation of the adaptive immune response. Regulates the development, function and differentiation of conventional T-cells and nonconventional NKT-cells. When antigen presenti
• PDB: 2DM0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	88 → 134	SH3 domain	Domain
  PF00017	SH2	150 → 231	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	271 → 520	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in T-cells and some myeloid cell lines. Expressed in Th1/Th0 cells with IFN-gamma-producing potential. {ECO:0000269|PubMed:10523612, ECO:0000269|PubMed:7951233}.
• Sequence:

  MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
  TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
  KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
  LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
  RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
  INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
  KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
  VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
  EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW

• Sequence length: 527

Pathways

KEGG:

Leukocyte transendothelial migration

Reactome:

FCERI mediated Ca+2 mobilization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	20561151, 40613333	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11698299	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23284953, 28455521, 35951003	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23625925	Associate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	Pubtator	39354406	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15654836	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	16809408		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	35967452	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10666407	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	31204551	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24190638, 27627582, 31728013, 35872868	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12594741, 12853700, 17505063, 17855441, 18283037, 18781181, 19661439, 21595894, 21947652, 21978374, 22658320, 22687878, 24427781, 24469035, 25648557, 25714853, 26089344, 26358790, 26420498, 27441659, 28539531, 28966246, 30115380, 30987650, 32710281, 33034269, 35850772, 37445934, 9461516	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	33224144, 7809124, 9545398	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16189274, 18781181, 32022484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	19174819, 27301516	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19835603, 30367591, 31732298, 32378800, 33289342, 35695930, 36670097, 36893885, 37603831, 37844378, 39406114	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	19174819	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23467750, 27220961, 27834463, 28068944, 28114889, 28358873, 30416077, 30837581, 31545459, 33296352, 34319001, 34580162, 36263616, 37024096, 37460463, 37517099, 37541245, 37943357, 38098449, 38172737	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26026587, 28385611, 31401413	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	1701695, 22261807, 24351833, 32859636	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36730312	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	23793017	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33070556, 34603331	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	12181402, 16825501	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	30573803	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	7509341	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	3206110, 37207222, 8530527	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	7678609	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12699056, 14726674, 15548175, 17007015, 19051325, 22026926, 7678609	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	37934158	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	16387954	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37331566	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	11872746	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15008986	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29129599		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	2002058	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24343817	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23060048, 34691070	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	16387954, 21705501, 21819482, 36517458, 37248740, 37454239, 38551368, 38563187, 40474715, 40533930	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21819482	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23426935	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	28883705	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	34438042	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	15269295, 16912224, 17200352, 17396139, 17435539, 19765109, 20028860, 20512492, 22365521, 23550148, 24639192, 25080996, 25886408, 28448384, 35499757, 37108337, 37616163	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31842391	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17189383, 22701710, 23696788	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18519000, 20237991	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	19182535	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	31931069	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	31204551	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11468177	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	16387954, 37248740, 38563187	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	28951244	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14534291	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	26277103	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29263297	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27886173		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27886173	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	2002058, 31899992	Associate	★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann syndrome	Pubtator	26277103	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27220961	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1306324, 16393970, 16403907, 17229652, 19470474, 19625708, 2125038, 23333150, 24837466, 29463564, 31122263, 31349760, 36220999	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	9292513	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	16042351, 18519632, 3170574	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15178581, 16150941, 16912224, 17229652, 18252861, 18270328, 20380868, 21705501, 22126574, 22208491, 22800464, 23616623, 24200998, 25006129, 26784138, 26929621, 28522571, 28895560, 29463564, 29723246, 31088841, 33514657, 34024909, 34941036, 40181449, 8754809	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	20863376	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22728287	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15329413, 18422739, 19414361, 21681119, 22523180, 23020723, 23733853, 24092472, 24280348, 24297085, 25546157, 25691052, 25971727, 26058074, 26925681, 28420725, 29355391, 29396253, 29398453, 30055651, 32881389, 33963267, 34710947, 35927783	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20392785, 26905105, 34729927	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	10856194	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	33514657, 37248740, 37454239, 38551368, 40474715, 40533930	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23185384	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	16912224	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19244381, 19417143	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16186104, 18305571	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17872495, 24293999	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22939401	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36341423	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15860661	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	15860661, 16081687, 17013813, 21318952	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	34455066	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19414383, 23696342, 26616860, 39177282	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	38178234	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	8541539	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12910520, 16855388, 27599579, 33812182, 9346940	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22322295, 25690786, 26381405, 31959629, 8260363	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	22426987	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	7627271	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	15837627, 15860661, 16081687, 17976517, 19484334, 34058439	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21867506, 22278289, 25950519, 29891507, 33608991, 36749798, 9520419	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29129599		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35130915	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	38183115	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	35377340	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	24284293	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	29216400	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	28950372	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23681745	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	28298564	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	9182906	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15008986, 15654836	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	27145273	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24343817, 25946135	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12671705, 15161014, 22799357, 23803102, 27437872	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	15837627, 15860661, 16081687, 17013813	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31204551	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	25546157, 27097545, 30552230	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36686473	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	37675898	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21947652, 32841270	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	36686473	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	18266105, 36042208, 37991016	Associate	★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	34811450	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34286546	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11731569, 27690342, 30338793	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22728287	Associate	★☆☆☆☆ Found in Text Mining only