CCR2 (C-C motif chemokine receptor 2)

Gene

• Entrez ID: 729230
• Gene name: C-C motif chemokine receptor 2
• Gene symbol: CCR2
• Synonyms (NCBI Gene): CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R, PCLUD
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018230	hsa-miR-335-5p	Microarray	18185580
MIRT037379	hsa-miR-744-3p	CLASH	23622248
MIRT527319	hsa-miR-618	PAR-CLIP	22012620
MIRT527318	hsa-miR-532-5p	PAR-CLIP	22012620
MIRT527316	hsa-miR-4539	PAR-CLIP	22012620
MIRT527317	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT527315	hsa-miR-214-5p	PAR-CLIP	22012620
MIRT527313	hsa-miR-6811-3p	PAR-CLIP	22012620
MIRT527314	hsa-miR-4633-5p	PAR-CLIP	22012620
MIRT527312	hsa-miR-6514-3p	PAR-CLIP	22012620
MIRT527319	hsa-miR-618	PAR-CLIP	22012620
MIRT527318	hsa-miR-532-5p	PAR-CLIP	22012620
MIRT527316	hsa-miR-4539	PAR-CLIP	22012620
MIRT527317	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT527315	hsa-miR-214-5p	PAR-CLIP	22012620
MIRT527313	hsa-miR-6811-3p	PAR-CLIP	22012620
MIRT527314	hsa-miR-4633-5p	PAR-CLIP	22012620
MIRT527312	hsa-miR-6514-3p	PAR-CLIP	22012620
MIRT756300	hsa-miR-125a-5p	Luciferase reporter assay, Immunofluorescence	35401562
MIRT873202	hsa-miR-1179	CLIP-seq
MIRT873203	hsa-miR-144	CLIP-seq
MIRT873204	hsa-miR-2053	CLIP-seq
MIRT873205	hsa-miR-4699-3p	CLIP-seq
MIRT873206	hsa-miR-548ac	CLIP-seq
MIRT873207	hsa-miR-548ae	CLIP-seq
MIRT873208	hsa-miR-548aj	CLIP-seq
MIRT873209	hsa-miR-548am	CLIP-seq
MIRT873210	hsa-miR-548d-3p	CLIP-seq
MIRT873211	hsa-miR-548x	CLIP-seq
MIRT873212	hsa-miR-548z	CLIP-seq
MIRT1959078	hsa-miR-1236	CLIP-seq
MIRT1959079	hsa-miR-412	CLIP-seq
MIRT1959080	hsa-miR-4753-3p	CLIP-seq
MIRT1959081	hsa-miR-4778-3p	CLIP-seq
MIRT2196022	hsa-miR-1273e	CLIP-seq
MIRT2196023	hsa-miR-383	CLIP-seq
MIRT2196024	hsa-miR-4327	CLIP-seq
MIRT2196025	hsa-miR-4711-5p	CLIP-seq
MIRT2196026	hsa-miR-578	CLIP-seq
MIRT2196027	hsa-miR-1207-3p	CLIP-seq
MIRT2196028	hsa-miR-4267	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	19156404
RELA	Activation	19156404

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0001974	Process	Blood vessel remodeling	ISS
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0002548	Process	Monocyte chemotaxis	IEA
GO:0002724	Process	Regulation of T cell cytokine production	IEA
GO:0002724	Process	Regulation of T cell cytokine production	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10623817
GO:0005515	Function	Protein binding	IPI	23938203, 25283965, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15995708
GO:0005886	Component	Plasma membrane	IDA	15995708, 18587271
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8146186, 10741397
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10623817
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10623817
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10751368
GO:0006959	Process	Humoral immune response	IEA
GO:0006968	Process	Cellular defense response	IEA
GO:0006968	Process	Cellular defense response	TAS	10201901
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	8995400
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9548499
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	9670957
GO:0009611	Process	Response to wounding	TAS	8146186
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010574	Process	Regulation of vascular endothelial growth factor production	IEA
GO:0010574	Process	Regulation of vascular endothelial growth factor production	ISS
GO:0010820	Process	Positive regulation of T cell chemotaxis	IEA
GO:0010820	Process	Positive regulation of T cell chemotaxis	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8530354
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IDA	35570218
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	15995708
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019725	Process	Cellular homeostasis	IEA
GO:0019725	Process	Cellular homeostasis	ISS
GO:0019955	Function	Cytokine binding	IEA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031727	Function	CCR2 chemokine receptor binding	IDA	15995708
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035696	Process	Monocyte extravasation	IEA
GO:0035696	Process	Monocyte extravasation	ISS
GO:0035705	Process	T-helper 17 cell chemotaxis	IEA
GO:0035705	Process	T-helper 17 cell chemotaxis	ISS
GO:0035715	Function	Chemokine (C-C motif) ligand 2 binding	IEA
GO:0035716	Function	Chemokine (C-C motif) ligand 12 binding	IEA
GO:0035717	Function	Chemokine (C-C motif) ligand 7 binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043204	Component	Perikaryon	ISS
GO:0043310	Process	Negative regulation of eosinophil degranulation	IEA
GO:0043310	Process	Negative regulation of eosinophil degranulation	ISS
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	ISS
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061756	Process	Leukocyte adhesion to vascular endothelial cell	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	35570218
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	9182688
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071675	Process	Regulation of mononuclear cell migration	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	18587271
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	ISS
GO:0090265	Process	Positive regulation of immune complex clearance by monocytes and macrophages	IEA
GO:0090265	Process	Positive regulation of immune complex clearance by monocytes and macrophages	ISS
GO:0090594	Process	Inflammatory response to wounding	IEA
GO:0090594	Process	Inflammatory response to wounding	ISS
GO:0097350	Process	Neutrophil clearance	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24906148
GO:1900451	Process	Positive regulation of glutamate receptor signaling pathway	ISS
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1905517	Process	Macrophage migration	IEA
GO:1905517	Process	Macrophage migration	ISS
GO:1905521	Process	Regulation of macrophage migration	IEA
GO:2000404	Process	Regulation of T cell migration	IEA
GO:2000412	Process	Positive regulation of thymocyte migration	IEA
GO:2000412	Process	Positive regulation of thymocyte migration	ISS
GO:2000439	Process	Positive regulation of monocyte extravasation	IEA
GO:2000439	Process	Positive regulation of monocyte extravasation	ISS
GO:2000451	Process	Positive regulation of CD8-positive, alpha-beta T cell extravasation	IEA
GO:2000451	Process	Positive regulation of CD8-positive, alpha-beta T cell extravasation	ISS
GO:2000464	Process	Positive regulation of astrocyte chemotaxis	IDA	12271471
GO:2000473	Process	Positive regulation of hematopoietic stem cell migration	IEA
GO:2000473	Process	Positive regulation of hematopoietic stem cell migration	ISS

Other IDs

• MIM: 601267
• HGNC: 1603
• e!Ensembl: ENSG00000121807

Protein

• UniProt ID: P41597
• Protein name: C-C chemokine receptor type 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (Monocyte chemoattractant protein 1 receptor) (MCP-1-R) (CD antigen CD192)
• Protein function: Key functional receptor for CCL2 but can also bind CCL7, and CCL12 (PubMed:23408426, PubMed:38157855, PubMed:8048929, PubMed:8146186). Also transduces signaling mediated by CCL13 (PubMed:38157855). Its binding with CCL2 on monocytes and macropha
• PDB: 2MLO, 2MLQ, 5T1A, 7P8X, 7XA3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	59 → 305	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed by monocytes and IL2-activated NK cells (PubMed:9058802). Abundantly expressed on CD14+/CD16- monocytes and weakly on CD14+/CD16+ monocytes, type 2 dendritic cells (DCs) and plasmacytoid DCs (at protein level) (PubMed:3815785
• Sequence:

  MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
  MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
  HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
  CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
  AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
  NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
  GRAPEASLQDKEGA

• Sequence length: 374

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Beta defensins
Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cystic disease of lung	Pathogenic	rs2529520604, rs752561542, rs2529521725, rs1268159081, rs113340633	RCV003984972 RCV003984973 RCV003984974 RCV003984975 RCV003984976	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, PSORIATIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCR2-related disorder	Benign; protective; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LUNG DISEASE	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREDIABETES SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	Benign; protective; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS, INTERMEDIATE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS, POSTERIOR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	22863765		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29440506		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	22861370, 30179264		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27980102		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31547819		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	11603815		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18172114, 20206286, 21126357, 22789920, 23185481, 24142887, 24664727, 29360187, 29664944		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	28458180		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	23454776		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	14609568		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22607625, 29352259	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23380586	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15488313, 26553058		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	30981714		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22685564, 28651542		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	22685564	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29697532		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27354473, 29196437, 31297636		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	16524739		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	28969474	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30201767		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30201767		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	16308497	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16308497, 21220372		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	31034839		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	16308497		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10995790, 11282297, 11755917, 12426226, 12548076, 13678532, 16001983, 16356504, 18096169, 19506371, 21756880, 21779871, 21868018, 23029475, 28235712, 28246398, 28536301, 28914666, 29251559, 29378168, 29861387		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10323454, 12509607, 15827759, 20153665, 24696480, 30397205		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	18576354, 20133607, 28619088, 29880013	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11352233, 11762935, 18576354, 27411480, 31554310, 31729947, 33508012	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36194479	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20153665		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19082218, 19520154, 23454776, 24560857, 30264679, 31700522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19520154, 20220260, 23454776, 23804543	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	10995790, 11282297, 11755917, 12426226, 12548076, 13678532, 16001983, 16356504, 18096169, 19506371, 21756880, 21779871, 21868018, 23029475, 28235712, 28246398, 28536301, 28914666, 29251559, 29378168, 29861387		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17499741, 17587761, 18164016	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	22752804		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32383373, 33834070, 35790963	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11966764, 15827759, 26341401, 28580944, 31676674		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33386704, 35725391	Associate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	30981714		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10068655		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	26890122	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23632061, 30816510		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20449800, 22982413		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	21097672	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34375978	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28025034		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	35443752	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21344235, 22160640, 22927430, 25716470, 26996066, 27820834, 28420351, 29133591, 29934505, 30151375, 30446625, 31189648, 31208996		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20605053, 28420351, 34775491	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	19082218		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	11518728, 17442967		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29751565		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29751565	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	35408790	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	22041342	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	24970800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26648448	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27820834		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29115520, 36938723, 39756577	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20449800, 22982413		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25797207, 26733169, 30788000		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23551967	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23657965, 24327013, 27409666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22718118, 33717076, 37856813	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10623817, 28650671		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22537745, 25312802		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37796701	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28566450, 29186373, 31109070		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	19506371, 34140767	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	19506371		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	16308497, 18060801	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	27746376		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28059456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	22769019	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22769019	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22769019, 28746827, 30026864, 30628839		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15721423, 17094383, 17688234, 20537184, 26982176		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26982176, 31223426		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15721423, 17094383, 17688234, 20537184, 23427179, 26982176		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27980102		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31547819		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33045415	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	29802947		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29953538		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17728497, 19196047		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30340464		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20520640		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10727989, 22276574, 28045644		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	17413295		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30937946		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26531691, 29352259, 35026420, 36601110	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29848996		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	29352259	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28698550, 31182817, 31306468		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34717557	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22614322, 29020986, 30764543, 30986521, 31501414		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29020986, 29154245, 33175885	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	19559392		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12719858, 17395051, 29892064, 30661445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23657965		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	16306213		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11500196, 12239249, 12426226, 12719858, 17329566, 17482150, 21868018, 22752804, 27013693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11500196, 12239249, 12719858, 16480760, 17329566, 17383752, 17482150, 18617279, 21868018, 22752804, 27013693		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12742282, 36077273	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27013693	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11500196, 12239249, 12719858, 17329566, 17482150, 21868018, 22752804, 27013693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	17482150		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11377705, 22848538		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15306587	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19000946	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11352237, 12509607, 23185004, 26578310, 27746376, 27965260, 30403025		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25370917, 29993042		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28780056		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17374397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	23472158		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27221979		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	11603815		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19587356, 25816097, 27914709, 29805075, 31439648		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19587356, 25816097, 27914709, 29359616, 29805075, 31439648		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28454543, 29992758, 36077273	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22787171	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	28761107	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17428349, 32806763	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10400139, 12770795, 15135805, 22787171, 28761107, 29266506, 30975755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11756347, 21508925, 25816097, 28536301		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31439648		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17728497, 36969169	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17728497, 17968528, 18579703, 19587356, 21779871, 22006533, 23986513, 27914709		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30607767		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30374624		★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	24142887		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	19920349		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25222269		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	29673232	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	37876509	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	23472158		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	30532529	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	21131425, 22377584, 29202854, 30258000, 30715407		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	12486156, 15857890		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20364004		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	28951454	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34251980	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14981141, 21685244		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	28736230	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31785482		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28716963		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12680626		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29360187		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25816097, 28323124		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26028579, 28076416, 28323124, 28677333, 29448843		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29561839, 30597038		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	29392310		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28747747		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28692738		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17703277		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35464424	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17703277		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	18055544	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27788494, 37862725	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	37908345	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	21508925, 31566438		★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	28059456		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	20206286, 22789920, 24142887, 29360187		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	15812393	Stimulate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29319128		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	29319128	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	37730733	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36266640	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30650073		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12719858, 29892064, 30661445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	37796701	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	29446073		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32393308	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	10357837, 11755917, 14743961, 20206286, 9848893		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	10357837	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31439648		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	16781696, 28235712		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	10357837	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22769019	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15059935, 16461193, 28125278, 31566438		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	34876548	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25411969, 32033172	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30402462	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	11603815		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31320454		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24583146		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33755690	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27788494		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	15995708		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	28951454	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	20153790		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10786999, 19493994, 21610146, 22957692		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25370917, 29720578, 29848996		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11603815		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	22384201, 27863550		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11156639		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15306587, 29743615	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28780056		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26839895, 33508012	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	17417600	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15721423		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24083412, 30026864, 30794846		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37001853	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11756347, 19587356, 27914709, 30597038, 31498850		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18055544, 22041342, 36372857, 37862725, 38174742	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37908345	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17728497, 21508925		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18235145	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22041342	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17728497, 19196047		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	12770795		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	14632750		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	19618084	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28045930		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27258612	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28045930		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21570337		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17413295, 20740585, 26452628, 27980102, 28716525, 28754304, 29115520, 30894684, 31266773		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	17413295		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20548789, 30239650	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	20548789	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	22861370	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30228938		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19620293	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28045644, 28780502		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19309748, 35422093	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	30984198	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	30984198	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	14673999, 23298254, 28954264	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30984198		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12913933, 28954264		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	12913933, 20231199		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	38441377	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26992207	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21943176		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31919622	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	11736935	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	10068655, 20038229		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10068655, 20038229		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10068655, 20038229		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23185481, 25503251	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22159219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21344235, 22160640, 22927430, 25716470, 26996066, 27820834, 28420351, 29133591, 29500278, 29934505, 30151375, 30446625, 31189648, 31208996		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20364004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27980102, 28754304, 30132565		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25797207, 26733169, 30788000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21570337		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10623817, 28650671		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23653148, 27055731		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17216598, 19002595, 22612293, 23632061, 23839224, 23982944, 24406043, 25266801, 28039457, 30871130		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18306985		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20449800, 22982413		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17216598, 17257744, 17898181, 21091093, 21943176, 23612252, 23657965, 23876399, 26452628, 26806351, 27262929, 28424406, 28650671, 28730964, 28914666, 29337566, 29500278, 29751565, 29805075, 31578820, 31705064		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15721423, 17094383, 17688234, 20537184, 26982176		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30446625		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31547819		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	31547819	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31983065	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25370917, 29993042		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	27013693	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21779871		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19559392		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	19559392	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	19559392	Associate	★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	21131425		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36849997	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	16297158, 17672867	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	16306213, 17672867, 20628649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	20520640		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12357369, 12644822		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12644822, 12823344, 21097672	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14644039, 16001983, 16709257, 20637631, 25149422, 25242631, 25604634, 26979087		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30759186	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	27655900		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	28736230	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	23225384, 29561896		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	14533004		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11477473, 12719858, 12853162, 16207551, 16356504, 17383752, 20182805, 27013693, 28663258, 30410330, 30582448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	32594092	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16574901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	24950695		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	24388654	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10623817, 17094383, 17257744, 18093816, 18373164, 20842059, 21610146, 22160640, 22982413, 23427179, 23441216, 23585426, 23653148, 23695722, 25716470, 26416897, 26733169, 26806351, 27055731, 27816731, 27820834, 28202513, 28212753, 28420351, 28570817, 28754304, 28783667, 29170400, 29337566, 29500278, 29956585, 30132565, 30232521, 30504064, 30552233, 31154396, 31266773, 31297636, 31823764, 31827233		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28168553, 31566438		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20842059		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36923280	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20681057, 27487732		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	30542122		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	17116220		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	31566438		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28323124, 29420066, 29733805, 31843499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25797207, 25966143, 28424406		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28076416, 29420066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20017911, 27481183, 28454543	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20103702, 23986513, 29280303		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23804543	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	33965903	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11352237, 30403025, 31554310, 34876548	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	29128509	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23185004, 26578310		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	22081934		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22081934		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33061329	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30062520		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	21029462		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10623817		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28650671		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10623817, 19351767, 26211665, 33921111	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30410330		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23653148, 27055731		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31297636		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36497150	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23372702		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12889089, 15488313, 25370917, 30165873, 31471711		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30294923	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35026420	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	12889089		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29802947		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17216598, 19002595, 22612293, 23632061, 23839224, 23982944, 24406043, 25266801, 28039457, 30871130		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17216598, 23839224, 25266801, 28039457, 33514011, 36321189, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30410330		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	15370700, 28011143	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20153665, 23472158, 29277337		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29145242		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	29484482		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33680092	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37200921	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	14609568		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26456580, 28780502, 29332538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23657965, 24327013		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12889997, 15067318, 15827759, 16001983, 25779331, 29251559, 30190721, 30366278, 30975755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	23454776		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10351956, 10988120, 12882757, 15750046, 18513341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	31189648		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26906930		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30470612		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33680092, 35216350	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30228938		★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	29239897		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24867165, 29535830, 29720578, 31472096		★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	27816731		★☆☆☆☆ Found in Text Mining only
Skin Abnormalities	Skin abnormalities	Pubtator	15370700	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	28954264	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	27965260		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28954264		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28783667		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	25411969	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21883707, 22718118		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28533507	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29864522		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	19490431, 20034406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	28716963, 31785482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25816097, 28323124, 30179264, 31843499		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18306985		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21091093, 25411415, 26992207	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22769019	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22769019	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30117729		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24583146, 30470612		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	19646633		★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	30628839		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36266640	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19646633		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33587979	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20449800	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	23727176		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26982176	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17094383, 20537184, 26982176	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	17417600	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19506371		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	31004011		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	39186910	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19263529	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28464004		★☆☆☆☆ Found in Text Mining only