MEIKIN (meiotic kinetochore factor)

Gene

• Entrez ID: 728637
• Gene name: Meiotic kinetochore factor
• Gene symbol: MEIKIN
• Synonyms (NCBI Gene): SPO13
• Chromosome: 5
• Chromosome location: 5q31.1

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	ISS
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000779	Component	Condensed chromosome, centromeric region	ISS
GO:0005694	Component	Chromosome	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007060	Process	Male meiosis chromosome segregation	IBA
GO:0007060	Process	Male meiosis chromosome segregation	IEA
GO:0007060	Process	Male meiosis chromosome segregation	ISS
GO:0010789	Process	Meiotic sister chromatid cohesion involved in meiosis I	IBA
GO:0010789	Process	Meiotic sister chromatid cohesion involved in meiosis I	IEA
GO:0010789	Process	Meiotic sister chromatid cohesion involved in meiosis I	ISS
GO:0016321	Process	Female meiosis chromosome segregation	IBA
GO:0016321	Process	Female meiosis chromosome segregation	IEA
GO:0016321	Process	Female meiosis chromosome segregation	ISS
GO:0045143	Process	Homologous chromosome segregation	IBA
GO:0045143	Process	Homologous chromosome segregation	IEA
GO:0045143	Process	Homologous chromosome segregation	ISS
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051754	Process	Meiotic sister chromatid cohesion, centromeric	IBA
GO:0051754	Process	Meiotic sister chromatid cohesion, centromeric	IEA
GO:0051754	Process	Meiotic sister chromatid cohesion, centromeric	IEA
GO:0051754	Process	Meiotic sister chromatid cohesion, centromeric	ISS

Other IDs

• MIM: 616232
• HGNC: 51253
• e!Ensembl: ENSG00000239642

Protein

• UniProt ID: A0A087WXM9
• Protein name: Meiosis-specific kinetochore protein
• Protein function: Key regulator of kinetochore function during meiosis I: required both for mono-orientation of kinetochores on sister chromosomes and protection of centromeric cohesin from separase-mediated cleavage. Acts by facilitating kinetochore mono-orienta
• Sequence:

  MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGG
  SGSGPFSPRLGVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSELVSGLSL
  HHGMASSLLSYSVTDSYAEYKSFEESFPSPELFRKSDYLDWECPNLEEHMQWKNSTLLDT
  SKAVAIEKAPQFSNVSAIFSTSSEDYQKCHRKTVMTVADQNVSPKAKCASNSESDNAACE
  ILLAEKTCPSTPEKTKKKKTNSSTPGKKNRGLLTSTPSSETAGFVIDLSSVQKASFEELF
  PNVSNYVNSNEIVPVSSLQENSSNEFPANASEICCIIRTSPGTRQVKNKGVIVKKKKYSL
  PKDTPQDIIIKMA

• Sequence length: 373

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	25778476		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	18718982		★☆☆☆☆ Found in Text Mining only