Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	728489
Gene name	DNL-type zinc finger
Gene symbol	DNLZ
Synonyms (NCBI Gene)	C9orf151HEPHEP1TIMM15ZIM17bA413M3.2
Chromosome	9
Chromosome location	9q34.3

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048063	hsa-miR-197-3p	CLASH	23622248
MIRT488259	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT488257	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT488256	hsa-miR-3141	PAR-CLIP	20371350
MIRT488255	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT488254	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT488253	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT488252	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT488251	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT488250	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT488249	hsa-miR-4419a	PAR-CLIP	20371350
MIRT488248	hsa-miR-4510	PAR-CLIP	20371350
MIRT488247	hsa-miR-6127	PAR-CLIP	20371350
MIRT488246	hsa-miR-6129	PAR-CLIP	20371350
MIRT488245	hsa-miR-6130	PAR-CLIP	20371350
MIRT488244	hsa-miR-6133	PAR-CLIP	20371350
MIRT488243	hsa-miR-658	PAR-CLIP	20371350
MIRT488242	hsa-miR-3202	PAR-CLIP	20371350
MIRT488241	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT488240	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT488239	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT488237	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT488238	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT488259	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT488258	hsa-miR-9500	PAR-CLIP	23592263
MIRT488257	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT488256	hsa-miR-3141	PAR-CLIP	23592263
MIRT488255	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT488254	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT488253	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT488252	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT488251	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT488250	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT488249	hsa-miR-4419a	PAR-CLIP	23592263
MIRT488248	hsa-miR-4510	PAR-CLIP	23592263
MIRT488247	hsa-miR-6127	PAR-CLIP	23592263
MIRT488246	hsa-miR-6129	PAR-CLIP	23592263
MIRT488245	hsa-miR-6130	PAR-CLIP	23592263
MIRT488244	hsa-miR-6133	PAR-CLIP	23592263
MIRT488243	hsa-miR-658	PAR-CLIP	23592263
MIRT488242	hsa-miR-3202	PAR-CLIP	23592263
MIRT488241	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT488240	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT488239	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT488237	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT488238	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT488236	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT488235	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT488234	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT488233	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT488232	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT488231	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT488230	hsa-miR-296-5p	PAR-CLIP	23592263
MIRT488229	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT488228	hsa-miR-6745	PAR-CLIP	23592263
MIRT488227	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT488226	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT488225	hsa-miR-1293	PAR-CLIP	23592263
MIRT488223	hsa-miR-4483	PAR-CLIP	23592263
MIRT488224	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT488222	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT488221	hsa-miR-891a-3p	PAR-CLIP	23592263
MIRT488220	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT488259	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT488257	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT488256	hsa-miR-3141	PAR-CLIP	20371350
MIRT488255	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT488254	hsa-miR-6798-5p	PAR-CLIP	20371350
MIRT488253	hsa-miR-7113-5p	PAR-CLIP	20371350
MIRT488252	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT488251	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT488250	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT488249	hsa-miR-4419a	PAR-CLIP	20371350
MIRT488248	hsa-miR-4510	PAR-CLIP	20371350
MIRT488247	hsa-miR-6127	PAR-CLIP	20371350
MIRT488246	hsa-miR-6129	PAR-CLIP	20371350
MIRT488245	hsa-miR-6130	PAR-CLIP	20371350
MIRT488244	hsa-miR-6133	PAR-CLIP	20371350
MIRT488243	hsa-miR-658	PAR-CLIP	20371350
MIRT488242	hsa-miR-3202	PAR-CLIP	20371350
MIRT488241	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT488240	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT488239	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT488237	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT488238	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT488259	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT488258	hsa-miR-9500	PAR-CLIP	23592263
MIRT488257	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT488256	hsa-miR-3141	PAR-CLIP	23592263
MIRT488255	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT488254	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT488253	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT488252	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT488251	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT488250	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT488249	hsa-miR-4419a	PAR-CLIP	23592263
MIRT488248	hsa-miR-4510	PAR-CLIP	23592263
MIRT488247	hsa-miR-6127	PAR-CLIP	23592263
MIRT488246	hsa-miR-6129	PAR-CLIP	23592263
MIRT488245	hsa-miR-6130	PAR-CLIP	23592263
MIRT488244	hsa-miR-6133	PAR-CLIP	23592263
MIRT488243	hsa-miR-658	PAR-CLIP	23592263
MIRT488242	hsa-miR-3202	PAR-CLIP	23592263
MIRT488241	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT488240	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT488239	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT488237	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT488238	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT488236	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT488235	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT488234	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT488233	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT488232	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT488231	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT488230	hsa-miR-296-5p	PAR-CLIP	23592263
MIRT488229	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT488228	hsa-miR-6745	PAR-CLIP	23592263
MIRT488227	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT488226	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT488225	hsa-miR-1293	PAR-CLIP	23592263
MIRT488223	hsa-miR-4483	PAR-CLIP	23592263
MIRT488224	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT488222	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT488221	hsa-miR-891a-3p	PAR-CLIP	23592263
MIRT488220	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT942235	hsa-miR-1972	CLIP-seq
MIRT942236	hsa-miR-4717-5p	CLIP-seq
MIRT942237	hsa-miR-570	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IDA	33857516
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	33857516
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	33857516
GO:0006457	Process	Protein folding	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030150	Process	Protein import into mitochondrial matrix	IBA
GO:0044183	Function	Protein folding chaperone	IDA	33857516
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IBA
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	33857516

MIM	HGNC	e!Ensembl
620797	33879	ENSG00000213221

Q5SXM8

Protein name

DNL-type zinc finger protein (Hsp70-escort protein 1) (HEP1) (mtHsp70-escort protein)

Protein function

May function as a co-chaperone towards HSPA9/mortalin which, by itself, is prone to self-aggregation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05180	zf-DNL	70 → 135	DNL zinc finger	Domain

Sequence

MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAA
LGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLN
GKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS

Sequence length

178

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	30239062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	12377985		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11571575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11571575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30314340, 31382059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	11277983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29396688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	37062285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	22524153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	17401459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11147830, 11216860, 11230749, 12107653, 12160483, 12960125, 16054781, 16075462, 1648543, 16530734, 16596285, 17047197, 19923357, 21132267, 22028922 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11147830, 11230749, 12160483, 16054781, 1648543, 22524153, 24956259, 24968707, 25036133, 26778158, 28442387, 28948615, 9173087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11571575, 16698585, 24677392, 28083769, 30314340, 31382059, 31642074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11230749, 28083769, 29025661, 31382059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11571575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30314340, 31382059		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30260627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15531234, 17047197, 17401459, 17593797, 17950002, 19226333, 20127020, 22524153, 23376363, 24399246, 29025661, 29535278, 29679278, 29963149, 30150431, 30819081, 30847820 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30260627, 3998711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30573200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30573200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16144916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DNLZ (DNL-type zinc finger)