Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7284
Gene name	Tu translation elongation factor, mitochondrial
Gene symbol	TUFM
Synonyms (NCBI Gene)	COXPD4EF-TuMTEFTUP43
Chromosome	16
Chromosome location	16p11.2
Summary	This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has b

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs146326033	T>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs863224246	T>C	Likely-pathogenic	Coding sequence variant, missense variant

137

Show/Hide all (137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050010	hsa-miR-28-5p	CLASH	23622248
MIRT049214	hsa-miR-92a-3p	CLASH	23622248
MIRT045200	hsa-miR-186-5p	CLASH	23622248
MIRT043186	hsa-miR-324-5p	CLASH	23622248
MIRT043186	hsa-miR-324-5p	CLASH	23622248
MIRT042804	hsa-miR-339-5p	CLASH	23622248
MIRT039619	hsa-miR-615-3p	CLASH	23622248
MIRT039619	hsa-miR-615-3p	CLASH	23622248
MIRT052711	hsa-miR-1260b	CLASH	23622248
MIRT1463661	hsa-miR-1909	CLIP-seq
MIRT1463662	hsa-miR-1972	CLIP-seq
MIRT1463663	hsa-miR-2355-5p	CLIP-seq
MIRT1463664	hsa-miR-3130-3p	CLIP-seq
MIRT1463665	hsa-miR-4468	CLIP-seq
MIRT1463666	hsa-miR-4514	CLIP-seq
MIRT1463667	hsa-miR-4645-5p	CLIP-seq
MIRT1463668	hsa-miR-4663	CLIP-seq
MIRT1463669	hsa-miR-4673	CLIP-seq
MIRT1463670	hsa-miR-4692	CLIP-seq
MIRT1463671	hsa-miR-4755-3p	CLIP-seq
MIRT1463672	hsa-miR-4756-3p	CLIP-seq
MIRT1463673	hsa-miR-4793-3p	CLIP-seq
MIRT1463674	hsa-miR-940	CLIP-seq
MIRT1923054	hsa-miR-2355-3p	CLIP-seq
MIRT1923055	hsa-miR-3909	CLIP-seq
MIRT1923056	hsa-miR-4646-3p	CLIP-seq
MIRT1923057	hsa-miR-676	CLIP-seq
MIRT2139399	hsa-miR-1233	CLIP-seq
MIRT2139400	hsa-miR-1243	CLIP-seq
MIRT2139401	hsa-miR-1245b-5p	CLIP-seq
MIRT2139402	hsa-miR-1301	CLIP-seq
MIRT1463661	hsa-miR-1909	CLIP-seq
MIRT2139403	hsa-miR-3142	CLIP-seq
MIRT2139404	hsa-miR-3654	CLIP-seq
MIRT2139405	hsa-miR-4419a	CLIP-seq
MIRT2139406	hsa-miR-4436b-3p	CLIP-seq
MIRT2139407	hsa-miR-4459	CLIP-seq
MIRT2139408	hsa-miR-4510	CLIP-seq
MIRT2139409	hsa-miR-4650-5p	CLIP-seq
MIRT2139410	hsa-miR-4659a-5p	CLIP-seq
MIRT2139411	hsa-miR-4659b-5p	CLIP-seq
MIRT2139412	hsa-miR-4712-3p	CLIP-seq
MIRT2139413	hsa-miR-4722-5p	CLIP-seq
MIRT2139414	hsa-miR-4761-3p	CLIP-seq
MIRT2139415	hsa-miR-4779	CLIP-seq
MIRT2139416	hsa-miR-4794	CLIP-seq
MIRT2139417	hsa-miR-5047	CLIP-seq
MIRT2139418	hsa-miR-671-5p	CLIP-seq
MIRT2139400	hsa-miR-1243	CLIP-seq
MIRT2139401	hsa-miR-1245b-5p	CLIP-seq
MIRT1463661	hsa-miR-1909	CLIP-seq
MIRT1463662	hsa-miR-1972	CLIP-seq
MIRT2360121	hsa-miR-22	CLIP-seq
MIRT2139403	hsa-miR-3142	CLIP-seq
MIRT2139404	hsa-miR-3654	CLIP-seq
MIRT2360122	hsa-miR-3940-5p	CLIP-seq
MIRT2360123	hsa-miR-4290	CLIP-seq
MIRT2139406	hsa-miR-4436b-3p	CLIP-seq
MIRT2139407	hsa-miR-4459	CLIP-seq
MIRT2360124	hsa-miR-4507	CLIP-seq
MIRT2139409	hsa-miR-4650-5p	CLIP-seq
MIRT2139412	hsa-miR-4712-3p	CLIP-seq
MIRT2139413	hsa-miR-4722-5p	CLIP-seq
MIRT2360125	hsa-miR-4731-5p	CLIP-seq
MIRT2139414	hsa-miR-4761-3p	CLIP-seq
MIRT2139415	hsa-miR-4779	CLIP-seq
MIRT2139416	hsa-miR-4794	CLIP-seq
MIRT2139418	hsa-miR-671-5p	CLIP-seq
MIRT1463674	hsa-miR-940	CLIP-seq
MIRT2139399	hsa-miR-1233	CLIP-seq
MIRT2139400	hsa-miR-1243	CLIP-seq
MIRT2139401	hsa-miR-1245b-5p	CLIP-seq
MIRT2139402	hsa-miR-1301	CLIP-seq
MIRT1463661	hsa-miR-1909	CLIP-seq
MIRT1463662	hsa-miR-1972	CLIP-seq
MIRT2360121	hsa-miR-22	CLIP-seq
MIRT1463663	hsa-miR-2355-5p	CLIP-seq
MIRT2139403	hsa-miR-3142	CLIP-seq
MIRT2139404	hsa-miR-3654	CLIP-seq
MIRT2360122	hsa-miR-3940-5p	CLIP-seq
MIRT2360123	hsa-miR-4290	CLIP-seq
MIRT2139405	hsa-miR-4419a	CLIP-seq
MIRT2139406	hsa-miR-4436b-3p	CLIP-seq
MIRT2139407	hsa-miR-4459	CLIP-seq
MIRT2360124	hsa-miR-4507	CLIP-seq
MIRT2139408	hsa-miR-4510	CLIP-seq
MIRT1463666	hsa-miR-4514	CLIP-seq
MIRT1463667	hsa-miR-4645-5p	CLIP-seq
MIRT2139409	hsa-miR-4650-5p	CLIP-seq
MIRT2139410	hsa-miR-4659a-5p	CLIP-seq
MIRT2139411	hsa-miR-4659b-5p	CLIP-seq
MIRT1463669	hsa-miR-4673	CLIP-seq
MIRT1463670	hsa-miR-4692	CLIP-seq
MIRT2139412	hsa-miR-4712-3p	CLIP-seq
MIRT2139413	hsa-miR-4722-5p	CLIP-seq
MIRT2360125	hsa-miR-4731-5p	CLIP-seq
MIRT1463671	hsa-miR-4755-3p	CLIP-seq
MIRT2139414	hsa-miR-4761-3p	CLIP-seq
MIRT2139415	hsa-miR-4779	CLIP-seq
MIRT2139416	hsa-miR-4794	CLIP-seq
MIRT2139417	hsa-miR-5047	CLIP-seq
MIRT2139418	hsa-miR-671-5p	CLIP-seq
MIRT1463674	hsa-miR-940	CLIP-seq
MIRT2139399	hsa-miR-1233	CLIP-seq
MIRT2139400	hsa-miR-1243	CLIP-seq
MIRT2139401	hsa-miR-1245b-5p	CLIP-seq
MIRT2139402	hsa-miR-1301	CLIP-seq
MIRT1463661	hsa-miR-1909	CLIP-seq
MIRT1463662	hsa-miR-1972	CLIP-seq
MIRT2360121	hsa-miR-22	CLIP-seq
MIRT1463663	hsa-miR-2355-5p	CLIP-seq
MIRT2139403	hsa-miR-3142	CLIP-seq
MIRT2139404	hsa-miR-3654	CLIP-seq
MIRT2360122	hsa-miR-3940-5p	CLIP-seq
MIRT2360123	hsa-miR-4290	CLIP-seq
MIRT2139405	hsa-miR-4419a	CLIP-seq
MIRT2139406	hsa-miR-4436b-3p	CLIP-seq
MIRT2139407	hsa-miR-4459	CLIP-seq
MIRT2360124	hsa-miR-4507	CLIP-seq
MIRT2139408	hsa-miR-4510	CLIP-seq
MIRT1463666	hsa-miR-4514	CLIP-seq
MIRT1463667	hsa-miR-4645-5p	CLIP-seq
MIRT2139409	hsa-miR-4650-5p	CLIP-seq
MIRT2139410	hsa-miR-4659a-5p	CLIP-seq
MIRT2139411	hsa-miR-4659b-5p	CLIP-seq
MIRT1463669	hsa-miR-4673	CLIP-seq
MIRT1463670	hsa-miR-4692	CLIP-seq
MIRT2139412	hsa-miR-4712-3p	CLIP-seq
MIRT2139413	hsa-miR-4722-5p	CLIP-seq
MIRT2360125	hsa-miR-4731-5p	CLIP-seq
MIRT1463671	hsa-miR-4755-3p	CLIP-seq
MIRT2139414	hsa-miR-4761-3p	CLIP-seq
MIRT2139415	hsa-miR-4779	CLIP-seq
MIRT2139416	hsa-miR-4794	CLIP-seq
MIRT2139417	hsa-miR-5047	CLIP-seq
MIRT2139418	hsa-miR-671-5p	CLIP-seq
MIRT1463674	hsa-miR-940	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003746	Function	Translation elongation factor activity	IBA
GO:0003746	Function	Translation elongation factor activity	IDA	9332382
GO:0003746	Function	Translation elongation factor activity	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0005515	Function	Protein binding	IPI	11741979, 25416956, 28611246, 31515488
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	9332382
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0006412	Process	Translation	IEA
GO:0006414	Process	Translational elongation	IDA	9332382
GO:0006414	Process	Translational elongation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070125	Process	Mitochondrial translational elongation	IBA

MIM	HGNC	e!Ensembl
602389	12420	ENSG00000178952

P49411

Protein name

Elongation factor Tu, mitochondrial (EF-Tu) (EC 3.6.5.3) (P43)

Protein function

GTP hydrolase that promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Also plays a role in the regulation of autophagy and innate immunity. Recruits ATG5-ATG12 and NLRX1 at mitochondria a

PDB

7A5G , 7O9K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00009	GTP_EFTU	55 → 249	Elongation factor Tu GTP binding domain	Domain
PF03144	GTP_EFTU_D2	272 → 341	Elongation factor Tu domain 2	Domain
PF03143	GTP_EFTU_D3	345 → 440	Elongation factor Tu C-terminal domain	Domain

Sequence

MAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLL
DAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIR
TVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQ
RFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG

Sequence length

452

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Combined oxidative phosphorylation defect type 4	Pathogenic; Likely pathogenic	rs1057518742, rs1057518743, rs924099073	RCV000412576 RCV000412638 RCV000578247	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Combined oxidative phosphorylation deficiency	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 4	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASE	—	ClinGen, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUFM-related disorder	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34700051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11292833, 20413730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24560518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11292833, 20413730		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15648093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	17160893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	30903008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33299012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15648093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26771213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28449687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined oxidative phosphorylation defect type 4	Combined Oxidative Phosphorylation Deficiency	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Combined Oxidative Phosphorylation Deficiency 4	Combined Oxidative Phosphorylation Deficiency	ORPHANET_DG	17160893		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 4	Combined Oxidative Phosphorylation Deficiency	GENOMICS_ENGLAND_DG	17160893, 26741492, 27604308, 28132884		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 4	Combined Oxidative Phosphorylation Deficiency	UNIPROT_DG	17160893		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 4	Combined Oxidative Phosphorylation Deficiency	BEFREE	30903008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 4	Combined Oxidative Phosphorylation Deficiency	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Oxidative Phosphorylation Deficiency 4	Combined Oxidative Phosphorylation Deficiency	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Abnormalities	Congenital abnormalities	Pubtator	17033963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28645610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	28132884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39280009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	30903008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24956270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24956270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	39280009	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	17160893, 28132884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	28132884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial cardiomyopathy	Mitochondrial Cardiomyopathy	BEFREE	30903008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21169334, 25735936	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neonatal Hypotonia	Hypotonia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	39280009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24560518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26449484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24956270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	Pubtator	17160893, 28132884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26771213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28645610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26876213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24956270		★★★★★ ★☆☆☆☆ Found in Text Mining only

TUFM (Tu translation elongation factor, mitochondrial)