Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7275
Gene name	TUB bipartite transcription factor
Gene symbol	TUB
Synonyms (NCBI Gene)	RDOBrd5
Chromosome	11
Chromosome location	11p15.4
Summary	This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as

334

Show/Hide all (334)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021923	hsa-miR-128-3p	Sequencing	20371350
MIRT022311	hsa-miR-124-3p	Microarray	18668037
MIRT024147	hsa-miR-221-3p	Sequencing	20371350
MIRT047219	hsa-miR-181c-5p	CLASH	23622248
MIRT021923	hsa-miR-128-3p	CLASH	23622248
MIRT044577	hsa-miR-320a	CLASH	23622248
MIRT037636	hsa-miR-744-5p	CLASH	23622248
MIRT036622	hsa-miR-940	CLASH	23622248
MIRT544955	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT544954	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT544953	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT544952	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT544951	hsa-miR-4775	PAR-CLIP	20371350
MIRT544950	hsa-miR-1297	PAR-CLIP	20371350
MIRT544949	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT544947	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT544948	hsa-miR-4465	PAR-CLIP	20371350
MIRT544946	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT544955	hsa-miR-374c-3p	PAR-CLIP	21572407
MIRT544954	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT544953	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT544952	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT544951	hsa-miR-4775	PAR-CLIP	21572407
MIRT544950	hsa-miR-1297	PAR-CLIP	21572407
MIRT544949	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT544947	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT544948	hsa-miR-4465	PAR-CLIP	21572407
MIRT544946	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544955	hsa-miR-374c-3p	PAR-CLIP	21572407
MIRT544954	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT544953	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT544952	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT544951	hsa-miR-4775	PAR-CLIP	21572407
MIRT544950	hsa-miR-1297	PAR-CLIP	21572407
MIRT544949	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT544947	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT544948	hsa-miR-4465	PAR-CLIP	21572407
MIRT544946	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT737920	hsa-miR-4692	HITS-CLIP	33718276
MIRT737921	hsa-miR-4514	HITS-CLIP	33718276
MIRT737923	hsa-miR-4742-5p	HITS-CLIP	33718276
MIRT544955	hsa-miR-374c-3p	PAR-CLIP	20371350
MIRT544954	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT544953	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT544952	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT544951	hsa-miR-4775	PAR-CLIP	20371350
MIRT544950	hsa-miR-1297	PAR-CLIP	20371350
MIRT544949	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT544947	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT544948	hsa-miR-4465	PAR-CLIP	20371350
MIRT544946	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT544955	hsa-miR-374c-3p	PAR-CLIP	21572407
MIRT544954	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT544953	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT544952	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT544951	hsa-miR-4775	PAR-CLIP	21572407
MIRT544950	hsa-miR-1297	PAR-CLIP	21572407
MIRT544949	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT544947	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT544948	hsa-miR-4465	PAR-CLIP	21572407
MIRT544946	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT544955	hsa-miR-374c-3p	PAR-CLIP	21572407
MIRT544954	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT544953	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT544952	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT544951	hsa-miR-4775	PAR-CLIP	21572407
MIRT544950	hsa-miR-1297	PAR-CLIP	21572407
MIRT544949	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT544947	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT544948	hsa-miR-4465	PAR-CLIP	21572407
MIRT544946	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT1462907	hsa-miR-134	CLIP-seq
MIRT1462908	hsa-miR-143	CLIP-seq
MIRT1462909	hsa-miR-153	CLIP-seq
MIRT1462910	hsa-miR-2113	CLIP-seq
MIRT1462911	hsa-miR-218	CLIP-seq
MIRT1462912	hsa-miR-2964a-5p	CLIP-seq
MIRT1462913	hsa-miR-3118	CLIP-seq
MIRT1462914	hsa-miR-3150b-3p	CLIP-seq
MIRT1462915	hsa-miR-3164	CLIP-seq
MIRT1462916	hsa-miR-3189-5p	CLIP-seq
MIRT1462917	hsa-miR-3200-5p	CLIP-seq
MIRT1462918	hsa-miR-3614-5p	CLIP-seq
MIRT1462919	hsa-miR-3616-3p	CLIP-seq
MIRT1462920	hsa-miR-3659	CLIP-seq
MIRT1462921	hsa-miR-4303	CLIP-seq
MIRT1462922	hsa-miR-4327	CLIP-seq
MIRT1462923	hsa-miR-448	CLIP-seq
MIRT1462924	hsa-miR-4639-5p	CLIP-seq
MIRT1462925	hsa-miR-4642	CLIP-seq
MIRT1462926	hsa-miR-4649-3p	CLIP-seq
MIRT1462927	hsa-miR-4658	CLIP-seq
MIRT1462928	hsa-miR-4682	CLIP-seq
MIRT1462929	hsa-miR-4721	CLIP-seq
MIRT1462930	hsa-miR-4762-3p	CLIP-seq
MIRT1462931	hsa-miR-4764-5p	CLIP-seq
MIRT1462932	hsa-miR-4770	CLIP-seq
MIRT1462933	hsa-miR-4777-3p	CLIP-seq
MIRT1462934	hsa-miR-4784	CLIP-seq
MIRT1462935	hsa-miR-4799-5p	CLIP-seq
MIRT1462936	hsa-miR-511	CLIP-seq
MIRT1462937	hsa-miR-574-5p	CLIP-seq
MIRT1462938	hsa-miR-603	CLIP-seq
MIRT1462939	hsa-miR-636	CLIP-seq
MIRT1462940	hsa-miR-122	CLIP-seq
MIRT1462941	hsa-miR-124	CLIP-seq
MIRT1462942	hsa-miR-1256	CLIP-seq
MIRT1462943	hsa-miR-1273g	CLIP-seq
MIRT1462944	hsa-miR-128	CLIP-seq
MIRT1462945	hsa-miR-1915	CLIP-seq
MIRT1462946	hsa-miR-19a	CLIP-seq
MIRT1462947	hsa-miR-19b	CLIP-seq
MIRT1462948	hsa-miR-2277-3p	CLIP-seq
MIRT1462949	hsa-miR-299-3p	CLIP-seq
MIRT1462950	hsa-miR-3121-3p	CLIP-seq
MIRT1462951	hsa-miR-3660	CLIP-seq
MIRT1462952	hsa-miR-4289	CLIP-seq
MIRT1462953	hsa-miR-4491	CLIP-seq
MIRT1462954	hsa-miR-4519	CLIP-seq
MIRT1462955	hsa-miR-4526	CLIP-seq
MIRT1462956	hsa-miR-4657	CLIP-seq
MIRT1462957	hsa-miR-4672	CLIP-seq
MIRT1462958	hsa-miR-4685-5p	CLIP-seq
MIRT1462959	hsa-miR-506	CLIP-seq
MIRT1462960	hsa-miR-548an	CLIP-seq
MIRT1462961	hsa-miR-556-5p	CLIP-seq
MIRT737922	hsa-miR-572	CLIP-seq
MIRT1462937	hsa-miR-574-5p	CLIP-seq
MIRT1462962	hsa-miR-581	CLIP-seq
MIRT1462938	hsa-miR-603	CLIP-seq
MIRT1462963	hsa-miR-610	CLIP-seq
MIRT1462964	hsa-miR-645	CLIP-seq
MIRT1462965	hsa-miR-647	CLIP-seq
MIRT1462938	hsa-miR-603	CLIP-seq
MIRT2139288	hsa-miR-3124-3p	CLIP-seq
MIRT2139289	hsa-miR-3173-3p	CLIP-seq
MIRT2139290	hsa-miR-345	CLIP-seq
MIRT2359994	hsa-miR-4272	CLIP-seq
MIRT2359995	hsa-miR-1237	CLIP-seq
MIRT2359996	hsa-miR-1248	CLIP-seq
MIRT2359997	hsa-miR-2467-5p	CLIP-seq
MIRT2359998	hsa-miR-3188	CLIP-seq
MIRT2359999	hsa-miR-3620	CLIP-seq
MIRT2360000	hsa-miR-362-5p	CLIP-seq
MIRT1462951	hsa-miR-3660	CLIP-seq
MIRT2360001	hsa-miR-3975	CLIP-seq
MIRT1462955	hsa-miR-4526	CLIP-seq
MIRT1462926	hsa-miR-4649-3p	CLIP-seq
MIRT2360002	hsa-miR-4675	CLIP-seq
MIRT2360003	hsa-miR-4722-3p	CLIP-seq
MIRT2360004	hsa-miR-4741	CLIP-seq
MIRT2360005	hsa-miR-485-5p	CLIP-seq
MIRT2360006	hsa-miR-500b	CLIP-seq
MIRT2360007	hsa-miR-501-5p	CLIP-seq
MIRT2360008	hsa-miR-515-5p	CLIP-seq
MIRT2360009	hsa-miR-767-3p	CLIP-seq
MIRT2396481	hsa-miR-1252	CLIP-seq
MIRT2396482	hsa-miR-3158-5p	CLIP-seq
MIRT2396483	hsa-miR-3166	CLIP-seq
MIRT2396484	hsa-miR-338-3p	CLIP-seq
MIRT2396485	hsa-miR-4418	CLIP-seq
MIRT2396486	hsa-miR-4771	CLIP-seq
MIRT2396487	hsa-miR-509-3-5p	CLIP-seq
MIRT2396488	hsa-miR-509-5p	CLIP-seq
MIRT2653148	hsa-miR-1178	CLIP-seq
MIRT2653149	hsa-miR-1205	CLIP-seq
MIRT2359995	hsa-miR-1237	CLIP-seq
MIRT1462942	hsa-miR-1256	CLIP-seq
MIRT2653150	hsa-miR-1258	CLIP-seq
MIRT1462943	hsa-miR-1273g	CLIP-seq
MIRT2653151	hsa-miR-1283	CLIP-seq
MIRT2653152	hsa-miR-1285	CLIP-seq
MIRT2653153	hsa-miR-1291	CLIP-seq
MIRT2653154	hsa-miR-129-3p	CLIP-seq
MIRT1462945	hsa-miR-1915	CLIP-seq
MIRT2653155	hsa-miR-194	CLIP-seq
MIRT2653156	hsa-miR-199a-3p	CLIP-seq
MIRT2653157	hsa-miR-199b-3p	CLIP-seq
MIRT2653158	hsa-miR-204	CLIP-seq
MIRT2653159	hsa-miR-2053	CLIP-seq
MIRT2653160	hsa-miR-211	CLIP-seq
MIRT2653161	hsa-miR-217	CLIP-seq
MIRT2653162	hsa-miR-296-5p	CLIP-seq
MIRT1462949	hsa-miR-299-3p	CLIP-seq
MIRT2653163	hsa-miR-302a	CLIP-seq
MIRT2653164	hsa-miR-302b	CLIP-seq
MIRT2653165	hsa-miR-302c	CLIP-seq
MIRT2653166	hsa-miR-302d	CLIP-seq
MIRT2653167	hsa-miR-302e	CLIP-seq
MIRT2653168	hsa-miR-3064-5p	CLIP-seq
MIRT2139288	hsa-miR-3124-3p	CLIP-seq
MIRT2653169	hsa-miR-3129-5p	CLIP-seq
MIRT2653170	hsa-miR-3130-3p	CLIP-seq
MIRT2653171	hsa-miR-3155	CLIP-seq
MIRT2653172	hsa-miR-3155b	CLIP-seq
MIRT2653173	hsa-miR-3160-5p	CLIP-seq
MIRT2653174	hsa-miR-3173-5p	CLIP-seq
MIRT2653175	hsa-miR-3187-3p	CLIP-seq
MIRT2653176	hsa-miR-3187-5p	CLIP-seq
MIRT2653177	hsa-miR-326	CLIP-seq
MIRT2653178	hsa-miR-330-5p	CLIP-seq
MIRT2653179	hsa-miR-335	CLIP-seq
MIRT2653180	hsa-miR-3611	CLIP-seq
MIRT1462918	hsa-miR-3614-5p	CLIP-seq
MIRT2653181	hsa-miR-3647-3p	CLIP-seq
MIRT2653182	hsa-miR-3658	CLIP-seq
MIRT2653183	hsa-miR-3665	CLIP-seq
MIRT2653184	hsa-miR-3667-5p	CLIP-seq
MIRT2653185	hsa-miR-3685	CLIP-seq
MIRT2653186	hsa-miR-3692	CLIP-seq
MIRT2653187	hsa-miR-371-5p	CLIP-seq
MIRT2653188	hsa-miR-371b-5p	CLIP-seq
MIRT2653189	hsa-miR-372	CLIP-seq
MIRT2653190	hsa-miR-373	CLIP-seq
MIRT2653191	hsa-miR-378g	CLIP-seq
MIRT2653192	hsa-miR-382	CLIP-seq
MIRT2653193	hsa-miR-384	CLIP-seq
MIRT2653194	hsa-miR-3976	CLIP-seq
MIRT2653195	hsa-miR-4274	CLIP-seq
MIRT1462952	hsa-miR-4289	CLIP-seq
MIRT2653196	hsa-miR-4302	CLIP-seq
MIRT2396485	hsa-miR-4418	CLIP-seq
MIRT2653197	hsa-miR-4436b-5p	CLIP-seq
MIRT2653198	hsa-miR-4473	CLIP-seq
MIRT2653199	hsa-miR-4486	CLIP-seq
MIRT1462953	hsa-miR-4491	CLIP-seq
MIRT2653200	hsa-miR-4496	CLIP-seq
MIRT2653201	hsa-miR-451b	CLIP-seq
MIRT2653202	hsa-miR-4529-5p	CLIP-seq
MIRT2653203	hsa-miR-4535	CLIP-seq
MIRT1462924	hsa-miR-4639-5p	CLIP-seq
MIRT2653204	hsa-miR-4640-5p	CLIP-seq
MIRT1462956	hsa-miR-4657	CLIP-seq
MIRT2653205	hsa-miR-4667-3p	CLIP-seq
MIRT1462957	hsa-miR-4672	CLIP-seq
MIRT2653206	hsa-miR-4687-3p	CLIP-seq
MIRT2653207	hsa-miR-4687-5p	CLIP-seq
MIRT2653208	hsa-miR-4694-3p	CLIP-seq
MIRT2653209	hsa-miR-4698	CLIP-seq
MIRT2653210	hsa-miR-4726-5p	CLIP-seq
MIRT2653211	hsa-miR-4732-3p	CLIP-seq
MIRT2653212	hsa-miR-4755-5p	CLIP-seq
MIRT1462933	hsa-miR-4777-3p	CLIP-seq
MIRT1462935	hsa-miR-4799-5p	CLIP-seq
MIRT2653213	hsa-miR-484	CLIP-seq
MIRT2653214	hsa-miR-492	CLIP-seq
MIRT2396487	hsa-miR-509-3-5p	CLIP-seq
MIRT2396488	hsa-miR-509-5p	CLIP-seq
MIRT2653215	hsa-miR-512-3p	CLIP-seq
MIRT2653216	hsa-miR-513a-3p	CLIP-seq
MIRT2653217	hsa-miR-519a	CLIP-seq
MIRT2653218	hsa-miR-519b-3p	CLIP-seq
MIRT2653219	hsa-miR-519c-3p	CLIP-seq
MIRT2653220	hsa-miR-520a-3p	CLIP-seq
MIRT2653221	hsa-miR-520b	CLIP-seq
MIRT2653222	hsa-miR-520c-3p	CLIP-seq
MIRT2653223	hsa-miR-520d-3p	CLIP-seq
MIRT2653224	hsa-miR-520e	CLIP-seq
MIRT2653225	hsa-miR-520f	CLIP-seq
MIRT2653226	hsa-miR-548a-3p	CLIP-seq
MIRT2653227	hsa-miR-548e	CLIP-seq
MIRT2653228	hsa-miR-548f	CLIP-seq
MIRT2653229	hsa-miR-556-3p	CLIP-seq
MIRT2653230	hsa-miR-570	CLIP-seq
MIRT1462962	hsa-miR-581	CLIP-seq
MIRT2653231	hsa-miR-612	CLIP-seq
MIRT2653232	hsa-miR-623	CLIP-seq
MIRT1462964	hsa-miR-645	CLIP-seq
MIRT2653233	hsa-miR-648	CLIP-seq
MIRT2653234	hsa-miR-657	CLIP-seq
MIRT2653235	hsa-miR-668	CLIP-seq
MIRT2653236	hsa-miR-888	CLIP-seq
MIRT2653237	hsa-miR-892b	CLIP-seq
MIRT1462942	hsa-miR-1256	CLIP-seq
MIRT2653150	hsa-miR-1258	CLIP-seq
MIRT1462943	hsa-miR-1273g	CLIP-seq
MIRT2653151	hsa-miR-1283	CLIP-seq
MIRT2653152	hsa-miR-1285	CLIP-seq
MIRT2653153	hsa-miR-1291	CLIP-seq
MIRT2653154	hsa-miR-129-3p	CLIP-seq
MIRT1462945	hsa-miR-1915	CLIP-seq
MIRT2653155	hsa-miR-194	CLIP-seq
MIRT2653158	hsa-miR-204	CLIP-seq
MIRT2653160	hsa-miR-211	CLIP-seq
MIRT2653161	hsa-miR-217	CLIP-seq
MIRT2653162	hsa-miR-296-5p	CLIP-seq
MIRT2653168	hsa-miR-3064-5p	CLIP-seq
MIRT2139288	hsa-miR-3124-3p	CLIP-seq
MIRT2653170	hsa-miR-3130-3p	CLIP-seq
MIRT2653171	hsa-miR-3155	CLIP-seq
MIRT2653172	hsa-miR-3155b	CLIP-seq
MIRT2653175	hsa-miR-3187-3p	CLIP-seq
MIRT2653176	hsa-miR-3187-5p	CLIP-seq
MIRT2653177	hsa-miR-326	CLIP-seq
MIRT2653178	hsa-miR-330-5p	CLIP-seq
MIRT2653179	hsa-miR-335	CLIP-seq
MIRT2653180	hsa-miR-3611	CLIP-seq
MIRT1462918	hsa-miR-3614-5p	CLIP-seq
MIRT2653181	hsa-miR-3647-3p	CLIP-seq
MIRT2653185	hsa-miR-3685	CLIP-seq
MIRT2653187	hsa-miR-371-5p	CLIP-seq
MIRT2653191	hsa-miR-378g	CLIP-seq
MIRT2653192	hsa-miR-382	CLIP-seq
MIRT2653193	hsa-miR-384	CLIP-seq
MIRT2653194	hsa-miR-3976	CLIP-seq
MIRT2653195	hsa-miR-4274	CLIP-seq
MIRT1462952	hsa-miR-4289	CLIP-seq
MIRT2396485	hsa-miR-4418	CLIP-seq
MIRT2653199	hsa-miR-4486	CLIP-seq
MIRT2653200	hsa-miR-4496	CLIP-seq
MIRT2653201	hsa-miR-451b	CLIP-seq
MIRT2653202	hsa-miR-4529-5p	CLIP-seq
MIRT2653203	hsa-miR-4535	CLIP-seq
MIRT2653205	hsa-miR-4667-3p	CLIP-seq
MIRT1462957	hsa-miR-4672	CLIP-seq
MIRT2653206	hsa-miR-4687-3p	CLIP-seq
MIRT2653207	hsa-miR-4687-5p	CLIP-seq
MIRT2653208	hsa-miR-4694-3p	CLIP-seq
MIRT2653212	hsa-miR-4755-5p	CLIP-seq
MIRT2653213	hsa-miR-484	CLIP-seq
MIRT2653214	hsa-miR-492	CLIP-seq
MIRT2396487	hsa-miR-509-3-5p	CLIP-seq
MIRT2396488	hsa-miR-509-5p	CLIP-seq
MIRT2653226	hsa-miR-548a-3p	CLIP-seq
MIRT2653227	hsa-miR-548e	CLIP-seq
MIRT2653228	hsa-miR-548f	CLIP-seq
MIRT2653229	hsa-miR-556-3p	CLIP-seq
MIRT2653230	hsa-miR-570	CLIP-seq
MIRT1462962	hsa-miR-581	CLIP-seq
MIRT2653231	hsa-miR-612	CLIP-seq
MIRT2653232	hsa-miR-623	CLIP-seq
MIRT1462964	hsa-miR-645	CLIP-seq
MIRT2653236	hsa-miR-888	CLIP-seq
MIRT2653237	hsa-miR-892b	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IDA	28154160
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	28154160
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	11000483
GO:0005737	Component	Cytoplasm	IDA	28154160
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	11000483
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IBA
GO:0005929	Component	Cilium	IDA	28154160
GO:0006909	Process	Phagocytosis	IEA
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0042073	Process	Intraciliary transport	IDA	28154160
GO:0044877	Function	Protein-containing complex binding	IDA	20889716
GO:0045494	Process	Photoreceptor cell maintenance	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IDA	19837063
GO:0060041	Process	Retina development in camera-type eye	IEA
GO:0061512	Process	Protein localization to cilium	IBA
GO:0061512	Process	Protein localization to cilium	IEA
GO:0097500	Process	Receptor localization to non-motile cilium	IEA
GO:0120160	Function	Intraciliary transport particle A binding	IDA	28154160
GO:1903546	Process	Protein localization to photoreceptor outer segment	IEA

MIM	HGNC	e!Ensembl
601197	12406	ENSG00000166402

P50607

Protein name

Tubby protein homolog

Protein function

Functions in signal transduction from heterotrimeric G protein-coupled receptors. Binds to membranes containing phosphatidylinositol 4,5-bisphosphate. Can bind DNA (in vitro). May contribute to the regulation of transcription in the nucleus. Cou

PDB

1S31

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16322	Tub_N	29 → 237	Tubby N-terminal	Family
PF01167	Tub	257 → 501	Tub family	Domain

Sequence

MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRR
ARQSEEQAPLVESYLSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQG
GAARKEKKGKHKGTSGPAALAEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQD
LRATMQRKGISSSMSFDEDEEDEEENSSSSSQLNSNTRPSSATSRKSVREAASAPSPTAP
EQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLA
GRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLES
GTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTE
SIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTM
DYNYPLCALQAFAIALSSFDSKLACE

Sequence length

506

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Retinal dystrophy and obesity	Pathogenic; Likely pathogenic	rs727502810, rs1589996458	RCV000149873 RCV000991211	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism spectrum disorder	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUB-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	16643894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28919751, 29976237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	36498982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36181111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone Dystrophy	Cone dystrophy	Pubtator	24375934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	16643894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31811175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17955208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10639573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10639573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	18183286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18183286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	16643894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber congenital amaurosis	Pubtator	16643894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28919751, 29976237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28919751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23146750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11000483, 16443771, 17955208, 18183286, 23146750, 24375934, 28852204, 9462750, 9462751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16443771, 16643894, 18183286, 24375934, 33983957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
obsolete Rod-cone dystrophy	Rod-cone dystrophy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	16643894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	36498982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINAL DYSTROPHY AND OBESITY	RETINAL DYSTROPHY AND OBESITY	BEFREE	24375934		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RETINAL DYSTROPHY AND OBESITY	RETINAL DYSTROPHY AND OBESITY	GENOMICS_ENGLAND_DG	8612280		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RETINAL DYSTROPHY AND OBESITY	RETINAL DYSTROPHY AND OBESITY	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RETINAL DYSTROPHY AND OBESITY	RETINAL DYSTROPHY AND OBESITY	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	16643894		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	16643894, 36650547	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis Pigmentosa	Retinitis Pigmentosa	ORPHANET_DG	24375934		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinitis pigmentosa	Retinitis Pigmentosa	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31198983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TUB (TUB bipartite transcription factor)