Gene Gene information from NCBI Gene database.
Entrez ID 7268
Gene name Tetratricopeptide repeat domain 4
Gene symbol TTC4
Synonyms (NCBI Gene)
CNS1
Chromosome 1
Chromosome location 1p32.3
Summary This gene encodes a protein that contains tetratricopeptide (TPR) repeats, which often mediate protein-protein interactions and chaperone activity. The encoded protein interacts with heat shock proteins 70 and 90. Alternative splicing results in multiple
miRNA miRNA information provided by mirtarbase database.
299
miRTarBase ID miRNA Experiments Reference
MIRT619061 hsa-miR-1306-5p HITS-CLIP 23824327
MIRT619060 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT619059 hsa-miR-764 HITS-CLIP 23824327
MIRT619058 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT619056 hsa-miR-1224-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 18320024, 25036637, 28514442, 29251827, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 18320024, 29251827
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606753 12394 ENSG00000243725
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95801
Protein name Tetratricopeptide repeat protein 4 (TPR repeat protein 4)
Protein function May act as a co-chaperone for HSP90AB1 (PubMed:18320024). Promotes Sendai virus (SeV)-induced host cell innate immune responses (PubMed:29251827).
PDB 6HFO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18972 Wheel 259 377 Cns1/TTC4 Wheel domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in proliferating tissue and tumor cell lines but not in normal cell lines. {ECO:0000269|PubMed:18320024}.
Sequence
MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPD
LACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLY
TNRAAAQYYLGNFRSALNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQI
DAKEKKLLEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQAIKARNIRLSEAACED
EDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYPEYAQSDFISAFHEDSRF
IDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKAL
TPAFLVCVGSSPFCKNF
LRGRKVYQIR
Sequence length 387
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 30303520
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 20658610
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 30303520
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 10639601, 18320024, 9933562
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 18320024 Associate
★☆☆☆☆
Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia Lymphoblastic Leukemia BEFREE 30303520
★☆☆☆☆
Found in Text Mining only
CNS disorder CNS Disorder BEFREE 20658610, 28535084
★☆☆☆☆
Found in Text Mining only
Crigler Najjar syndrome, type 1 Crigler-Najjar syndrome BEFREE 31495946
★☆☆☆☆
Found in Text Mining only
Cutaneous Melanoma Melanoma BEFREE 11126369
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 29604048
★☆☆☆☆
Found in Text Mining only