Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7262
Gene name	Pleckstrin homology like domain family A member 2
Gene symbol	PHLDA2
Synonyms (NCBI Gene)	BRW1CBWR1CHLDA2IPLTSSC3
Chromosome	11
Chromosome location	11p15.4
Summary	This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarco

100

Show/Hide all (100)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016330	hsa-miR-193b-3p	Microarray	20304954
MIRT028418	hsa-miR-30a-5p	Proteomics	18668040
MIRT029073	hsa-miR-26b-5p	Microarray	19088304
MIRT031541	hsa-miR-16-5p	Proteomics	18668040
MIRT700821	hsa-miR-6819-3p	HITS-CLIP	23313552
MIRT700820	hsa-miR-6877-3p	HITS-CLIP	23313552
MIRT700819	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT700818	hsa-miR-1205	HITS-CLIP	23313552
MIRT700817	hsa-miR-93-3p	HITS-CLIP	23313552
MIRT700816	hsa-miR-3692-5p	HITS-CLIP	23313552
MIRT700815	hsa-miR-339-3p	HITS-CLIP	23313552
MIRT700814	hsa-miR-6132	HITS-CLIP	23313552
MIRT700813	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT700812	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT700811	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT700810	hsa-miR-3195	HITS-CLIP	23313552
MIRT700809	hsa-miR-3135b	HITS-CLIP	23313552
MIRT700808	hsa-miR-185-5p	HITS-CLIP	23313552
MIRT700807	hsa-miR-4306	HITS-CLIP	23313552
MIRT700806	hsa-miR-4644	HITS-CLIP	23313552
MIRT700805	hsa-miR-5192	HITS-CLIP	23313552
MIRT700804	hsa-miR-3652	HITS-CLIP	23313552
MIRT700803	hsa-miR-4430	HITS-CLIP	23313552
MIRT700802	hsa-miR-4492	HITS-CLIP	23313552
MIRT700801	hsa-miR-4498	HITS-CLIP	23313552
MIRT700800	hsa-miR-5001-5p	HITS-CLIP	23313552
MIRT700799	hsa-miR-762	HITS-CLIP	23313552
MIRT700798	hsa-miR-6828-3p	HITS-CLIP	23313552
MIRT700797	hsa-miR-6071	HITS-CLIP	23313552
MIRT471109	hsa-miR-548e-5p	PAR-CLIP	23592263
MIRT471108	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016330	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT471107	hsa-miR-8062	PAR-CLIP	23592263
MIRT471106	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT471105	hsa-miR-4480	PAR-CLIP	23592263
MIRT471104	hsa-miR-3926	PAR-CLIP	23592263
MIRT471103	hsa-miR-106a-3p	PAR-CLIP	23592263
MIRT471102	hsa-miR-548s	PAR-CLIP	23592263
MIRT471101	hsa-miR-450b-5p	PAR-CLIP	23592263
MIRT700821	hsa-miR-6819-3p	HITS-CLIP	23313552
MIRT700820	hsa-miR-6877-3p	HITS-CLIP	23313552
MIRT700819	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT700818	hsa-miR-1205	HITS-CLIP	23313552
MIRT700817	hsa-miR-93-3p	HITS-CLIP	23313552
MIRT700816	hsa-miR-3692-5p	HITS-CLIP	23313552
MIRT700815	hsa-miR-339-3p	HITS-CLIP	23313552
MIRT700814	hsa-miR-6132	HITS-CLIP	23313552
MIRT700813	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT700812	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT700811	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT700810	hsa-miR-3195	HITS-CLIP	23313552
MIRT700809	hsa-miR-3135b	HITS-CLIP	23313552
MIRT700808	hsa-miR-185-5p	HITS-CLIP	23313552
MIRT700807	hsa-miR-4306	HITS-CLIP	23313552
MIRT700806	hsa-miR-4644	HITS-CLIP	23313552
MIRT700805	hsa-miR-5192	HITS-CLIP	23313552
MIRT700804	hsa-miR-3652	HITS-CLIP	23313552
MIRT700803	hsa-miR-4430	HITS-CLIP	23313552
MIRT700802	hsa-miR-4492	HITS-CLIP	23313552
MIRT700801	hsa-miR-4498	HITS-CLIP	23313552
MIRT700800	hsa-miR-5001-5p	HITS-CLIP	23313552
MIRT700799	hsa-miR-762	HITS-CLIP	23313552
MIRT700798	hsa-miR-6828-3p	HITS-CLIP	23313552
MIRT700797	hsa-miR-6071	HITS-CLIP	23313552
MIRT471109	hsa-miR-548e-5p	PAR-CLIP	23592263
MIRT471108	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016330	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT471107	hsa-miR-8062	PAR-CLIP	23592263
MIRT471106	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT471105	hsa-miR-4480	PAR-CLIP	23592263
MIRT471104	hsa-miR-3926	PAR-CLIP	23592263
MIRT471103	hsa-miR-106a-3p	PAR-CLIP	23592263
MIRT471102	hsa-miR-548s	PAR-CLIP	23592263
MIRT471101	hsa-miR-450b-5p	PAR-CLIP	23592263
MIRT1232016	hsa-miR-1283	CLIP-seq
MIRT1232017	hsa-miR-134	CLIP-seq
MIRT1232018	hsa-miR-1973	CLIP-seq
MIRT1232019	hsa-miR-3118	CLIP-seq
MIRT1232020	hsa-miR-3133	CLIP-seq
MIRT1232021	hsa-miR-3163	CLIP-seq
MIRT1232022	hsa-miR-3164	CLIP-seq
MIRT1232023	hsa-miR-323b-3p	CLIP-seq
MIRT1232024	hsa-miR-376c	CLIP-seq
MIRT1232025	hsa-miR-4501	CLIP-seq
MIRT1232026	hsa-miR-520d-5p	CLIP-seq
MIRT1232027	hsa-miR-524-3p	CLIP-seq
MIRT1232028	hsa-miR-524-5p	CLIP-seq
MIRT1232029	hsa-miR-525-3p	CLIP-seq
MIRT1232030	hsa-miR-548b-3p	CLIP-seq
MIRT2068062	hsa-miR-185	CLIP-seq
MIRT2068063	hsa-miR-1909	CLIP-seq
MIRT2068064	hsa-miR-3182	CLIP-seq
MIRT2068065	hsa-miR-4659a-3p	CLIP-seq
MIRT2068066	hsa-miR-4659b-3p	CLIP-seq
MIRT2068067	hsa-miR-4661-3p	CLIP-seq
MIRT2068068	hsa-miR-4681	CLIP-seq
MIRT2068069	hsa-miR-4746-5p	CLIP-seq
MIRT1232027	hsa-miR-524-3p	CLIP-seq
MIRT1232029	hsa-miR-525-3p	CLIP-seq
MIRT2068070	hsa-miR-937	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001890	Process	Placenta development	IBA
GO:0001890	Process	Placenta development	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	TAS	9328465
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0070873	Process	Regulation of glycogen metabolic process	IEA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IEA

MIM	HGNC	e!Ensembl
602131	12385	ENSG00000181649

Q53GA4

Protein name

Pleckstrin homology-like domain family A member 2 (Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein) (Imprinted in placenta and liver protein) (Tumor-suppressing STF cDNA 3 protein) (Tumor-suppressing subchromosomal transferable f

Protein function

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal

Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDC
VERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPA
APAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Sequence length

152

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29285217		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29660218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	BEFREE	30282379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29157002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28619530, 30270514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10749982, 15691381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39300389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30092789	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32385195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37474643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29660218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32385195	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	13129680, 16106198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	27859451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27523184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31194812	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37986381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29957739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28594977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10749982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole, Partial	Hydatidiform Mole	BEFREE	16106198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31658412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	15691381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29861842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10197590, 22021909, 24268429, 29660218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27523184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28106555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	29993027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	13129680, 22021909, 22610481, 26265454, 27044808, 29861842, 30092789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10749116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10749982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	15496427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	26385429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	31804625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	27775238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22021909, 22610481, 24268429, 26265454, 27044808, 29156746, 30092789, 31058093		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	22021909		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	26265454, 30092789	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	28765808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29143411, 30690812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28723781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	30803163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	27798108		★★★★★ ★☆☆☆☆ Found in Text Mining only

PHLDA2 (pleckstrin homology like domain family A member 2)