CAPN5 (calpain 5)

Gene

• Entrez ID: 726
• Gene name: Calpain 5
• Gene symbol: CAPN5
• Synonyms (NCBI Gene): ADNIV, HTRA3, VRNI, nCL-3
• Chromosome: 11
• Chromosome location: 11q13.5
• Summary: Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subuni

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs397514601	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs397514602	T>C	Pathogenic	Missense variant, coding sequence variant
rs886041303	C>T	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437674	hsa-miR-214-3p	Microarray, qRT-PCR	22815788
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT518617	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518616	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518615	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT518617	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT518616	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT518615	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT518617	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518616	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518615	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518617	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518616	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518615	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT861968	hsa-miR-1237	CLIP-seq
MIRT861969	hsa-miR-1254	CLIP-seq
MIRT861970	hsa-miR-1324	CLIP-seq
MIRT861971	hsa-miR-133a	CLIP-seq
MIRT861972	hsa-miR-133b	CLIP-seq
MIRT861973	hsa-miR-214	CLIP-seq
MIRT861974	hsa-miR-3116	CLIP-seq
MIRT861975	hsa-miR-3120-3p	CLIP-seq
MIRT861976	hsa-miR-3127-3p	CLIP-seq
MIRT861977	hsa-miR-3166	CLIP-seq
MIRT861978	hsa-miR-3190	CLIP-seq
MIRT861979	hsa-miR-346	CLIP-seq
MIRT861980	hsa-miR-3614-5p	CLIP-seq
MIRT861981	hsa-miR-3619-5p	CLIP-seq
MIRT861982	hsa-miR-3650	CLIP-seq
MIRT861983	hsa-miR-3663-5p	CLIP-seq
MIRT861984	hsa-miR-377	CLIP-seq
MIRT861985	hsa-miR-3918	CLIP-seq
MIRT861986	hsa-miR-3974	CLIP-seq
MIRT861987	hsa-miR-4252	CLIP-seq
MIRT861988	hsa-miR-4281	CLIP-seq
MIRT861989	hsa-miR-4496	CLIP-seq
MIRT861990	hsa-miR-4512	CLIP-seq
MIRT861991	hsa-miR-4527	CLIP-seq
MIRT861992	hsa-miR-4688	CLIP-seq
MIRT861993	hsa-miR-4697-3p	CLIP-seq
MIRT861994	hsa-miR-4727-5p	CLIP-seq
MIRT861995	hsa-miR-4769-3p	CLIP-seq
MIRT861996	hsa-miR-486-3p	CLIP-seq
MIRT861997	hsa-miR-617	CLIP-seq
MIRT861998	hsa-miR-661	CLIP-seq
MIRT861999	hsa-miR-761	CLIP-seq
MIRT862000	hsa-miR-873	CLIP-seq
MIRT1546145	hsa-miR-1285	CLIP-seq
MIRT1546146	hsa-miR-4508	CLIP-seq
MIRT1546145	hsa-miR-1285	CLIP-seq
MIRT861970	hsa-miR-1324	CLIP-seq
MIRT1955739	hsa-miR-137	CLIP-seq
MIRT1955740	hsa-miR-1909	CLIP-seq
MIRT861973	hsa-miR-214	CLIP-seq
MIRT1955741	hsa-miR-2467-5p	CLIP-seq
MIRT861975	hsa-miR-3120-3p	CLIP-seq
MIRT1955742	hsa-miR-3610	CLIP-seq
MIRT861981	hsa-miR-3619-5p	CLIP-seq
MIRT1955743	hsa-miR-4286	CLIP-seq
MIRT1955744	hsa-miR-4492	CLIP-seq
MIRT1955745	hsa-miR-4498	CLIP-seq
MIRT1955746	hsa-miR-4505	CLIP-seq
MIRT1955747	hsa-miR-4646-5p	CLIP-seq
MIRT861999	hsa-miR-761	CLIP-seq
MIRT1955748	hsa-miR-762	CLIP-seq
MIRT1955749	hsa-miR-922	CLIP-seq
MIRT1546145	hsa-miR-1285	CLIP-seq
MIRT2193376	hsa-miR-15a	CLIP-seq
MIRT2193377	hsa-miR-15b	CLIP-seq
MIRT2193378	hsa-miR-16	CLIP-seq
MIRT2193379	hsa-miR-195	CLIP-seq
MIRT2193380	hsa-miR-3184	CLIP-seq
MIRT2193381	hsa-miR-3913-3p	CLIP-seq
MIRT2193382	hsa-miR-423-5p	CLIP-seq
MIRT2193383	hsa-miR-424	CLIP-seq
MIRT1955743	hsa-miR-4286	CLIP-seq
MIRT2193384	hsa-miR-4468	CLIP-seq
MIRT2193385	hsa-miR-4514	CLIP-seq
MIRT2193386	hsa-miR-4660	CLIP-seq
MIRT2193387	hsa-miR-4690-5p	CLIP-seq
MIRT2193388	hsa-miR-4692	CLIP-seq
MIRT2193389	hsa-miR-489	CLIP-seq
MIRT2193390	hsa-miR-497	CLIP-seq
MIRT2193391	hsa-miR-541	CLIP-seq
MIRT2193392	hsa-miR-646	CLIP-seq
MIRT2193393	hsa-miR-654-5p	CLIP-seq
MIRT1546145	hsa-miR-1285	CLIP-seq
MIRT2193384	hsa-miR-4468	CLIP-seq
MIRT2385529	hsa-miR-4736	CLIP-seq
MIRT1546145	hsa-miR-1285	CLIP-seq
MIRT2496462	hsa-miR-29a	CLIP-seq
MIRT2496463	hsa-miR-29b	CLIP-seq
MIRT2496464	hsa-miR-29c	CLIP-seq
MIRT2496465	hsa-miR-329	CLIP-seq
MIRT2496466	hsa-miR-362-3p	CLIP-seq
MIRT2496467	hsa-miR-3663-3p	CLIP-seq
MIRT2496468	hsa-miR-4299	CLIP-seq
MIRT2496469	hsa-miR-4456	CLIP-seq
MIRT2496470	hsa-miR-4522	CLIP-seq
MIRT2496471	hsa-miR-4710	CLIP-seq
MIRT2496472	hsa-miR-4792	CLIP-seq
MIRT2496473	hsa-miR-548q	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004198	Function	Calcium-dependent cysteine-type endopeptidase activity	IBA
GO:0004198	Function	Calcium-dependent cysteine-type endopeptidase activity	IEA
GO:0004198	Function	Calcium-dependent cysteine-type endopeptidase activity	TAS	9339374
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007165	Process	Signal transduction	TAS	9339374
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0009986	Component	Cell surface	IDA	23055945
GO:0016787	Function	Hydrolase activity	IEA
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 602537
• HGNC: 1482
• e!Ensembl: ENSG00000149260

Protein

• UniProt ID: O15484
• Protein name: Calpain-5 (EC 3.4.22.-) (Calpain htra-3) (New calpain 3) (nCL-3)
• Protein function: Calcium-regulated non-lysosomal thiol-protease.
• PDB: 6P3Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00648	Peptidase_C2	27 → 341	Calpain family cysteine protease	Family
  PF01067	Calpain_III	361 → 488	Calpain large subunit, domain III	Domain
  PF00168	C2	518 → 613	C2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many tissues. Strong expression in the photoreceptor cells of the retina, with a punctate pattern of labeling over the nuclei and inner segments with less expression along the other segments and outer plexiform layer. {ECO
• Sequence:

  MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICED
  PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGI
  FHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGG
  NTADALVDFTGGVSEPIDLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADM
  EARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
  EWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLH
  GAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGE
  NLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHT
  GEFLLRVFTDVPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYV
  IIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKAD
  PDNLQALHTLHLRDRNSRQPSNLPGTVAVHILSSTSLMAV

• Sequence length: 640

Pathways

Reactome:

Degradation of the extracellular matrix

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant neovascular inflammatory vitreoretinopathy	Pathogenic	rs397514601	RCV001535499	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
CAPN5-related disorder	Pathogenic	rs886041303	RCV004757186	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proliferative vitreoretinopathy	Pathogenic	rs886041303, rs397514601, rs397514602, rs1950456995	RCV000626481 RCV000033027 RCV000033028 RCV001078182	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAPN5-RELATED VITREORETINOPATHY	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Late-onset cone-rod dystrophy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Occult macular dystrophy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITREORETINOPATHY, NEOVASCULAR INFLAMMATORY	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	31110225		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23055945	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal dominant neovascular inflammatory vitreoretinopathy	Neovascular Inflammatory Vitreoretinopathy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Blindness	Blindness	Pubtator	25216694, 29040051	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	23055945	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17227582		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17227582		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	25856303	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	29472286	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17227582, 24280871	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16396936		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23055945	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	23055945, 25856303, 27152965		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18829447	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25017104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	27152965		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	25856303	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	29472286	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16396936		★☆☆☆☆ Found in Text Mining only
Limb-girdle muscular dystrophy type 2A	Limb-girdle muscular dystrophy	BEFREE	9771675		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23555315		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27152965		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28193203		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17227582		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19225898		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33811937	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29245980		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	28193203		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16396936, 17151322, 18657264		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18657264	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral retinal neovascularization	Peripheral retinal neovascularization	HPO_DG			★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31110225		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16396936, 17227582		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	16396936		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	17227582	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31110225		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	ORPHANET_DG	23055945		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	UNIPROT_DG	23055945		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31110225		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinal Degeneration	Retinal degeneration	Pubtator	25856303, 29472286	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	25856303		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	25856303	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	31968260	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	27152965		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	31110225		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18787380		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	23055945, 25856303, 29472286, 32707200	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	25856303, 25994508		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	25856303, 32707200	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	16415965	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinal degeneration	Vitreoretinal degeneration	BEFREE	25856303, 31110225		★☆☆☆☆ Found in Text Mining only
Vitreoretinal degeneration	Vitreoretinal degeneration	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	25856303, 29472286, 30986125, 31110225	Associate	★☆☆☆☆ Found in Text Mining only