TRPM2 (transient receptor potential cation channel subfamily M member 2)

Gene

• Entrez ID: 7226
• Gene name: Transient receptor potential cation channel subfamily M member 2
• Gene symbol: TRPM2
• Synonyms (NCBI Gene): EREG1, KNP3, LTRPC2, LTrpC-2, NUDT9H, NUDT9L1, TRPC7
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: The protein encoded by this gene forms a tetrameric cation channel that is permeable to calcium, sodium, and potassium and is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042627	hsa-miR-423-3p	CLASH	23622248
MIRT1457298	hsa-miR-1269	CLIP-seq
MIRT1457299	hsa-miR-1269b	CLIP-seq
MIRT1457300	hsa-miR-1288	CLIP-seq
MIRT1457301	hsa-miR-1324	CLIP-seq
MIRT1457302	hsa-miR-1909	CLIP-seq
MIRT1457303	hsa-miR-3616-3p	CLIP-seq
MIRT1457304	hsa-miR-3660	CLIP-seq
MIRT1457305	hsa-miR-4271	CLIP-seq
MIRT1457306	hsa-miR-4293	CLIP-seq
MIRT1457307	hsa-miR-4433	CLIP-seq
MIRT1457308	hsa-miR-4459	CLIP-seq
MIRT1457309	hsa-miR-4515	CLIP-seq
MIRT1457310	hsa-miR-4526	CLIP-seq
MIRT1457311	hsa-miR-4632	CLIP-seq
MIRT1457312	hsa-miR-4645-3p	CLIP-seq
MIRT1457313	hsa-miR-4721	CLIP-seq
MIRT1457314	hsa-miR-4725-3p	CLIP-seq
MIRT1457315	hsa-miR-4740-5p	CLIP-seq
MIRT1457316	hsa-miR-4768-3p	CLIP-seq
MIRT1457317	hsa-miR-4786-3p	CLIP-seq
MIRT1457318	hsa-miR-544b	CLIP-seq
MIRT1457319	hsa-miR-671-5p	CLIP-seq
MIRT2137124	hsa-miR-1286	CLIP-seq
MIRT2137125	hsa-miR-3155	CLIP-seq
MIRT2137126	hsa-miR-3155b	CLIP-seq
MIRT2137127	hsa-miR-3677-5p	CLIP-seq
MIRT2137128	hsa-miR-4323	CLIP-seq
MIRT2137129	hsa-miR-4435	CLIP-seq
MIRT2137130	hsa-miR-4436a	CLIP-seq
MIRT2137131	hsa-miR-4514	CLIP-seq
MIRT2137132	hsa-miR-4645-5p	CLIP-seq
MIRT2137133	hsa-miR-4673	CLIP-seq
MIRT2137134	hsa-miR-4692	CLIP-seq
MIRT2137135	hsa-miR-4755-3p	CLIP-seq
MIRT2137136	hsa-miR-484	CLIP-seq
MIRT2357943	hsa-miR-4771	CLIP-seq
MIRT2357944	hsa-miR-499a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001659	Process	Temperature homeostasis	ISS
GO:0002407	Process	Dendritic cell chemotaxis	IEA
GO:0002407	Process	Dendritic cell chemotaxis	ISS
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005261	Function	Monoatomic cation channel activity	IMP	27068538
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS	9806837
GO:0005272	Function	Sodium channel activity	IEA
GO:0005384	Function	Manganese ion transmembrane transporter activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	30467180
GO:0005509	Function	Calcium ion binding	IMP	19171771
GO:0005764	Component	Lysosome	IDA	27068538
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	27333281, 30467180
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	19171771
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	9806837
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	TAS	9806837
GO:0006828	Process	Manganese ion transport	IEA
GO:0009408	Process	Response to heat	IEA
GO:0014074	Process	Response to purine-containing compound	IMP	19171771
GO:0015278	Function	Intracellularly gated calcium channel activity	IMP	27068538
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IMP	27383051
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	27068538
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046873	Function	Metal ion transmembrane transporter activity	IEA
GO:0047631	Function	ADP-ribose diphosphatase activity	IDA	30467180
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IMP	27068538
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051289	Process	Protein homotetramerization	IDA	30467180
GO:0051489	Process	Regulation of filopodium assembly	IMP	27068538
GO:0055085	Process	Transmembrane transport	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	27068538
GO:0070588	Process	Calcium ion transmembrane transport	IDA	25620041, 27333281, 28775320, 29745897, 30467180
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071277	Process	Cellular response to calcium ion	IMP	19171771
GO:0071421	Process	Manganese ion transmembrane transport	IEA
GO:0071502	Process	Cellular response to temperature stimulus	IEA
GO:0071502	Process	Cellular response to temperature stimulus	ISS
GO:0071577	Process	Zinc ion transmembrane transport	IMP	27068538
GO:0072571	Function	Mono-ADP-D-ribose binding	IDA	30467180
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IEA
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IMP	19171771, 27068538
GO:0098703	Process	Calcium ion import across plasma membrane	IEA
GO:0098703	Process	Calcium ion import across plasma membrane	ISS
GO:0099604	Function	Ligand-gated calcium channel activity	IBA
GO:0099604	Function	Ligand-gated calcium channel activity	IDA	19171771, 25620041, 27333281, 28775320, 29745897, 30467180
GO:0099604	Function	Ligand-gated calcium channel activity	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

Other IDs

• MIM: 603749
• HGNC: 12339
• e!Ensembl: ENSG00000142185

Protein

• UniProt ID: O94759
• Protein name: Transient receptor potential cation channel subfamily M member 2 (Estrogen-responsive element-associated gene 1 protein) (Long transient receptor potential channel 2) (LTrpC-2) (LTrpC2) (Transient receptor potential channel 7) (TrpC7) (Transient receptor
• Protein function: [Isoform 1]: Nonselective, voltage-independent cation channel that mediates Na(+) and Ca(2+) influx, leading to increased cytoplasmic Ca(2+) levels (PubMed:11385575, PubMed:11509734, PubMed:11804595, PubMed:12594222, PubMed:15561722, PubMed:1660
• PDB: 6MIX, 6MIZ, 6MJ2, 6PUO, 6PUR, 6PUS, 6PUU, 7VQ1, 7VQ2, 8E6Q, 8E6R, 8E6S, 8E6T, 8E6U, 8E6V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18139	LSDAT_euk	140 → 408	SLOG in TRPM	Family
  PF00520	Ion_trans	797 → 1060	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes. {ECO:0000269|PubMed:11385575, ECO:0000269|PubMed:115
• Sequence:

  MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLS
  SWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQ
  EMPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNF
  NMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIG
  VATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP
  LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVA
  DVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFR
  EGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
  PSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVL
  VEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQ
  GVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILK
  ELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQL
  ALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLISFREKRLQD
  VGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLV
  CEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILS
  LDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNE
  RRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAF
  PEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAA
  PPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAALLSWEIYLKENYLQNRQFQQ
  KQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRA
  SGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNE
  KVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQ
  AGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLP
  LSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWI
  ETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFG
  AHY

• Sequence length: 1503

Pathways

KEGG:

NOD-like receptor signaling pathway
Oxytocin signaling pathway

Reactome:

TRP channels
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANORECTAL MALFORMATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTURBANCE IN MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	30888515		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17395433, 19004782		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	19004782		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	19004782	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29620272		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26311765, 31794795		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26311765, 31794795		★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	BEFREE	25984793		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34903714	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28332277	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28736241		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30257456		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16252251, 16733555, 19133961, 21140288, 22420591, 23277130, 26311765		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	16252251		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	23602965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	16252251		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25760728		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	31772034	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	26178079		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26178079, 8252481		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25760245, 26178079, 30810442	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34605693, 35156509	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	8049130		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25760728		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30933439		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29620272	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36619219, 8263017	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25576627		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29542681, 29972150, 30523061, 31250378		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29542681, 29671419, 31772034		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	23727186		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31455864		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29507145, 30914955		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23615072	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26558786, 30009973		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	23602965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	30483886		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30138713		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20515676, 21636972, 25084624, 26957303, 28108595, 29915540, 31144442		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20515676, 21636972, 25084624, 26957303, 28108595, 29915540, 31144442		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28108595	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27731349	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20515676		★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	26311765		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disturbance in mood	Mood Disorder	PSYGENET_DG	26311765		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	28970008		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	30997980	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30997980, 35854199	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16205735, 31794795		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35156509	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34605693	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	31796045, 34831634	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18225560, 30796690, 30984336		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18225560, 26088448	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18225560, 30796690, 30984336		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27731349	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29775644, 31735084		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32296107	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28668375		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29311807, 29416015, 29507145, 30999030, 31568632, 31794795		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	23727186		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27317297		★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	22226147, 27467453		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30191993, 31578243		★☆☆☆☆ Found in Text Mining only
Lateral Sclerosis	Lateral Sclerosis	BEFREE	21140288		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32312983	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	32312983	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32312983	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32423430	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30925291		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28461775		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30933439		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16733555		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26178079, 8252481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30933439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24931166, 27068538, 30888515		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29343514		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	28008929		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25760728		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18225560, 18957938, 29343514, 29490946, 30862883, 30925291, 30933439, 31575956, 31772034, 31780732		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	8252481		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	23602965		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	23602965		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18957938, 22897572, 24718909		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22897572, 34445066	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29507145		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28028935		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35881053	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	16733555		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30201769		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	18225560, 22897572	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25391657, 29490946, 30862883, 30925291, 30933439, 8252481		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29671419, 31513012		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23302782, 27694440, 30020827, 30229906, 30625984, 35428820, 36446940	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25391657, 27694440, 28569571, 30020827, 30229906, 30625984		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17395433, 26558786, 28199210, 30009973, 30625984, 31144442		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	23277130		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	23277130		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	28028935, 31445205		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26178079		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	34117854	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35100080	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33621194, 37608401	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29620272		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27957685, 30625984, 31004593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	27957685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	30625984	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28736241		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26558786, 30009973		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy atypical	Progressive supranuclear palsy	Pubtator	19004782	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24931166, 27068538, 30888515		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20029400, 27068538	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	8549673		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	23277130		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	23277130		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal fibrosis	Renal fibrosis	BEFREE	31655312		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31749869		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27792045, 31450153		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30483886		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28008929		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28008929	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29343514		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29343514, 34696681	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31772034	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	28008929	Associate	★☆☆☆☆ Found in Text Mining only
Urethral Obstruction	Urethral Obstruction	BEFREE	31655312		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	30138713		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	30138713		★☆☆☆☆ Found in Text Mining only