TRPC5 (transient receptor potential cation channel subfamily C member 5)

Gene

• Entrez ID: 7224
• Gene name: Transient receptor potential cation channel subfamily C member 5
• Gene symbol: TRPC5
• Synonyms (NCBI Gene): PPP1R159, TRP5
• Chromosome: X
• Chromosome location: Xq23
• Summary: This gene belongs to the transient receptor family. It encodes one of the seven mammalian TRPC (transient receptor potential channel) proteins. The encoded protein is a multi-pass membrane protein and is thought to form a receptor-activated non-selective

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038711	hsa-miR-29b-2-5p	CLASH	23622248
MIRT438273	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	25159093
MIRT438273	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	25159093
MIRT533448	hsa-miR-32-3p	PAR-CLIP	22012620
MIRT533446	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT533447	hsa-miR-4643	PAR-CLIP	22012620
MIRT533445	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT533444	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT533443	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT533442	hsa-miR-1913	PAR-CLIP	22012620
MIRT533441	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT533439	hsa-miR-4313	PAR-CLIP	22012620
MIRT533440	hsa-miR-3941	PAR-CLIP	22012620
MIRT533438	hsa-miR-4672	PAR-CLIP	22012620
MIRT533437	hsa-miR-466	PAR-CLIP	22012620
MIRT533436	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT533435	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT533448	hsa-miR-32-3p	PAR-CLIP	22012620
MIRT533446	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT533447	hsa-miR-4643	PAR-CLIP	22012620
MIRT533445	hsa-miR-6890-3p	PAR-CLIP	22012620
MIRT533444	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT533443	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT533442	hsa-miR-1913	PAR-CLIP	22012620
MIRT533441	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT533439	hsa-miR-4313	PAR-CLIP	22012620
MIRT533440	hsa-miR-3941	PAR-CLIP	22012620
MIRT533438	hsa-miR-4672	PAR-CLIP	22012620
MIRT533437	hsa-miR-466	PAR-CLIP	22012620
MIRT533436	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT533435	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1457251	hsa-miR-1193	CLIP-seq
MIRT1457252	hsa-miR-147b	CLIP-seq
MIRT1457253	hsa-miR-2392	CLIP-seq
MIRT1457254	hsa-miR-3605-5p	CLIP-seq
MIRT1457255	hsa-miR-873	CLIP-seq
MIRT2137099	hsa-miR-1288	CLIP-seq
MIRT2137100	hsa-miR-138	CLIP-seq
MIRT2137101	hsa-miR-3144-5p	CLIP-seq
MIRT2137102	hsa-miR-3191	CLIP-seq
MIRT2137103	hsa-miR-3199	CLIP-seq
MIRT2137104	hsa-miR-3671	CLIP-seq
MIRT2137105	hsa-miR-4456	CLIP-seq
MIRT2137106	hsa-miR-4652-5p	CLIP-seq
MIRT2137107	hsa-miR-491-5p	CLIP-seq
MIRT2137108	hsa-miR-541	CLIP-seq
MIRT2137109	hsa-miR-607	CLIP-seq
MIRT2137110	hsa-miR-628-5p	CLIP-seq
MIRT2137111	hsa-miR-654-5p	CLIP-seq
MIRT2357911	hsa-miR-1323	CLIP-seq
MIRT2357912	hsa-miR-548o	CLIP-seq
MIRT2651471	hsa-miR-374a	CLIP-seq
MIRT2651472	hsa-miR-374b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005262	Function	Calcium channel activity	IDA	16284075, 20164195
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	IMP	38959890
GO:0005262	Function	Calcium channel activity	TAS
GO:0005515	Function	Protein binding	IPI	20164195, 32110987
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	38959890
GO:0005886	Component	Plasma membrane	TAS	10493832
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	TAS	10493832
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007399	Process	Nervous system development	TAS	10493832
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0015279	Function	Store-operated calcium channel activity	IBA
GO:0015279	Function	Store-operated calcium channel activity	TAS	10493832
GO:0016020	Component	Membrane	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030276	Function	Clathrin binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IBA
GO:0034704	Component	Calcium channel complex	IDA	20164195
GO:0042805	Function	Actinin binding	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050774	Process	Negative regulation of dendrite morphogenesis	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IBA
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IEA
GO:0070782	Process	Phosphatidylserine exposure on apoptotic cell surface	IEA
GO:0070782	Process	Phosphatidylserine exposure on apoptotic cell surface	ISS
GO:0098793	Component	Presynapse	IEA
GO:1902630	Process	Regulation of membrane hyperpolarization	IEA

Other IDs

• MIM: 300334
• HGNC: 12337
• e!Ensembl: ENSG00000072315

Protein

• UniProt ID: Q9UL62
• Protein name: Short transient receptor potential channel 5 (TrpC5) (Transient receptor protein 5) (TRP-5) (hTRP-5) (hTRP5)
• Protein function: Forms a receptor-activated non-selective calcium permeant cation channel (PubMed:16284075, PubMed:38959890, PubMed:37137991). Mediates calcium-dependent phosphatidylserine externalization and apoptosis in neurons via its association with PLSCR1
• PDB: 6YSN, 7D4P, 7D4Q, 7E4T, 7WDB, 7X6C, 7X6I, 8GVW, 8GVX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	36 → 126	Ankyrin repeats (3 copies)	Repeat
  PF08344	TRP_2	176 → 238	Transient receptor ion channel II	Family
  PF00520	Ion_trans	363 → 636	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain with higher levels in fetal brain. Found in cerebellum and occipital pole. {ECO:0000269|PubMed:9687496}.
• Sequence:

  MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYN
  VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRR
  PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
  CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
  YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
  FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
  KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
  EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
  LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
  YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
  GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
  FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNL
  VKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRSFSTSSTELSQR
  DDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGP
  SLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
  LSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHK
  WGDGQEEQVTTRL

• Sequence length: 973

Pathways

KEGG:

Axon guidance
GnRH secretion

Reactome:

TRP channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Glioma susceptibility 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRPC5-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32205467	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	21291387		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	21291387		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30692584		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27165180		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30692584		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36323681	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24817631		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25579062, 28032400, 28600513		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28032400, 37174704	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28539583		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21690481, 30538066		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28864720		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27895148, 28000878, 29463225		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29463225	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	23869231	Associate	★☆☆☆☆ Found in Text Mining only
Congenital malformation syndrome	Congenital Malformation Syndrome	BEFREE	9741467		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29793963		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28539583		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30062674		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	25085710		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29217578, 31704171, 31749913		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31844148		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18211288, 39189437	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30942446		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26133660, 31812495		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	17351372		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21690481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	10493832		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Intellectual developmental disorder	Pubtator	15254149, 36323681	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Kidney Diseases	Kidney Disease	BEFREE	24231357, 29217578, 30953689, 31355338, 31749913		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31704171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25579062, 28032400, 28600513		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25159093, 30038709		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28864720		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10493832		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24582564		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31812495		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	29061651		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30413532		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18172497		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30692584		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	27165180		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37733241	Associate	★☆☆☆☆ Found in Text Mining only