Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7222
Gene name	Transient receptor potential cation channel subfamily C member 3
Gene symbol	TRPC3
Synonyms (NCBI Gene)	SCA41TRP3
Chromosome	4
Chromosome location	4q27
Summary	The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol se

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs142339351	C>T	Pathogenic	Missense variant, coding sequence variant

214

Show/Hide all (214)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020161	hsa-miR-130b-3p	Sequencing	20371350
MIRT024166	hsa-miR-221-3p	Sequencing	20371350
MIRT026076	hsa-miR-196a-5p	Sequencing	20371350
MIRT031132	hsa-miR-19b-3p	Sequencing	20371350
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT675932	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT675931	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT553353	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031132	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT553352	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020161	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT553351	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT553350	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT553349	hsa-miR-3666	PAR-CLIP	20371350
MIRT553348	hsa-miR-4295	PAR-CLIP	20371350
MIRT553347	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT553346	hsa-miR-5684	PAR-CLIP	20371350
MIRT553345	hsa-miR-576-3p	PAR-CLIP	20371350
MIRT026076	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT553344	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT553343	hsa-miR-4491	PAR-CLIP	20371350
MIRT553342	hsa-miR-4657	PAR-CLIP	20371350
MIRT553341	hsa-miR-4653-3p	PAR-CLIP	20371350
MIRT553339	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT553338	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT553337	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT553336	hsa-miR-527	PAR-CLIP	20371350
MIRT553353	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031132	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT553352	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020161	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT553351	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT553350	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT553349	hsa-miR-3666	PAR-CLIP	21572407
MIRT553348	hsa-miR-4295	PAR-CLIP	21572407
MIRT553347	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT553346	hsa-miR-5684	PAR-CLIP	21572407
MIRT553345	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT026076	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT553344	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT553343	hsa-miR-4491	PAR-CLIP	21572407
MIRT553342	hsa-miR-4657	PAR-CLIP	21572407
MIRT553341	hsa-miR-4653-3p	PAR-CLIP	21572407
MIRT553340	hsa-miR-4470	PAR-CLIP	21572407
MIRT553339	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT553338	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT553337	hsa-miR-518a-5p	PAR-CLIP	21572407
MIRT553336	hsa-miR-527	PAR-CLIP	21572407
MIRT553347	hsa-miR-454-3p	Luciferase reporter assayWestern blottingqRT-PCR	33732296
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT675932	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT675931	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT611905	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611904	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611903	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611902	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611901	hsa-miR-548z	HITS-CLIP	23824327
MIRT611900	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT611899	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT611898	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT553353	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031132	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT553352	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT020161	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT553351	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT553350	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT553349	hsa-miR-3666	PAR-CLIP	20371350
MIRT553348	hsa-miR-4295	PAR-CLIP	20371350
MIRT553347	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT553346	hsa-miR-5684	PAR-CLIP	20371350
MIRT553345	hsa-miR-576-3p	PAR-CLIP	20371350
MIRT026076	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT553344	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT553343	hsa-miR-4491	PAR-CLIP	20371350
MIRT553342	hsa-miR-4657	PAR-CLIP	20371350
MIRT553341	hsa-miR-4653-3p	PAR-CLIP	20371350
MIRT553339	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT553338	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT553337	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT553336	hsa-miR-527	PAR-CLIP	20371350
MIRT553353	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031132	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT553352	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT020161	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT553351	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT553350	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT553349	hsa-miR-3666	PAR-CLIP	21572407
MIRT553348	hsa-miR-4295	PAR-CLIP	21572407
MIRT553347	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT553346	hsa-miR-5684	PAR-CLIP	21572407
MIRT553345	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT026076	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT553344	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT553343	hsa-miR-4491	PAR-CLIP	21572407
MIRT553342	hsa-miR-4657	PAR-CLIP	21572407
MIRT553341	hsa-miR-4653-3p	PAR-CLIP	21572407
MIRT553340	hsa-miR-4470	PAR-CLIP	21572407
MIRT553339	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT553338	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT553337	hsa-miR-518a-5p	PAR-CLIP	21572407
MIRT553336	hsa-miR-527	PAR-CLIP	21572407
MIRT1457233	hsa-miR-330-3p	CLIP-seq
MIRT1457234	hsa-miR-339-5p	CLIP-seq
MIRT1457235	hsa-miR-34a	CLIP-seq
MIRT1457236	hsa-miR-34c-5p	CLIP-seq
MIRT1457237	hsa-miR-3617	CLIP-seq
MIRT1457238	hsa-miR-4281	CLIP-seq
MIRT1457239	hsa-miR-449a	CLIP-seq
MIRT1457240	hsa-miR-449b	CLIP-seq
MIRT1457241	hsa-miR-641	CLIP-seq
MIRT1457233	hsa-miR-330-3p	CLIP-seq
MIRT2137086	hsa-miR-4252	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005227	Function	Calcium-activated cation channel activity	IEA
GO:0005262	Function	Calcium channel activity	IDA	9417057, 9930701, 29726814, 30139744, 35051376
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS	9930701
GO:0005515	Function	Protein binding	IPI	10611319, 15744307, 15757897, 16407161, 17360584, 20095964, 21670282
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9368034, 25477146
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	TAS	9215637
GO:0007338	Process	Single fertilization	IBA
GO:0007602	Process	Phototransduction	TAS	9215637
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IDA	21062895
GO:0015279	Function	Store-operated calcium channel activity	IBA
GO:0015279	Function	Store-operated calcium channel activity	IDA	8646775, 10611319
GO:0015279	Function	Store-operated calcium channel activity	TAS	9215637
GO:0016020	Component	Membrane	IEA
GO:0033198	Process	Response to ATP	IDA	21062895
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0051592	Process	Response to calcium ion	IDA	21062895
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IDA	21062895
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IBA
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IDA	14505576
GO:1903244	Process	Positive regulation of cardiac muscle hypertrophy in response to stress	IDA	19287093

MIM	HGNC	e!Ensembl
602345	12335	ENSG00000138741

Q13507

Protein name

Short transient receptor potential channel 3 (TrpC3) (Transient receptor protein 3) (TRP-3) (hTrp-3) (hTrp3)

Protein function

Forms a receptor-activated non-selective calcium permeant cation channel (PubMed:29726814, PubMed:30139744, PubMed:35051376, PubMed:9417057, PubMed:9930701, PubMed:10611319). {ECO:0000269|PubMed:10611319, ECO:0000269|PubMed:29726814, ECO:0000269

PDB

5ZBG , 6CUD , 6D7L , 6DJS , 7DXB , 7DXC , 7DXD , 7DXE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08344	TRP_2	182 → 244	Transient receptor ion channel II	Family
PF00520	Ion_trans	372 → 670	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in brain and at much lower levels in ovary, colon, small intestine, lung, prostate, placenta and testis.

Sequence

MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDY
MGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKR
LTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDY
FCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIE
KEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLA
IKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPC
SRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTT
QFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFL
QATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSR
IAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFT
TVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINS
SYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRIVNFPKCRRR
RLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRLIKRYVLKAQV
DKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE

Sequence length

836

Interactions

View interactions

	KEGG		Reactome
	Axon guidance Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases		Effects of PIP2 hydrolysis Elevation of cytosolic Ca2+ levels TRP channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Spinocerebellar ataxia type 41	Pathogenic	rs2149125943	RCV001647209	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATAXIA, SPINOCEREBELLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 41	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIAS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRPC3-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (101)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21603869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36809524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27903970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29290366, 29387339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16574942, 27317689	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	28034747, 29624776		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia	Ataxia	Pubtator	21931279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	29290366, 29387339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	22992321, 30153442, 31680473		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	22420591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	23602965		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	22692672, 31003514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22692672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35870973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32087757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21603869, 23580589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	21931279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28768915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	21931279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Late Onset	Cerebellar Ataxia	BEFREE	21321808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21802402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30550855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35870973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17382525, 22992321, 28645743, 28790356, 31680473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18787184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18787184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18787184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30318928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	23602965		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28716528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30962089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27573367, 35909537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30962089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30342505		★★★★★ ★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	27798555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39689787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic Ataxia	BEFREE	21321808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18177730, 22438881, 27861908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22438881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	15358862	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	29748835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30078005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18211288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	39189437	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	26219954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17382525, 22992321, 28645743, 28790356, 31680473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	22566418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28790356, 29312514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19136933, 21957871, 30139744	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Malignant	Malignant hypertension	Pubtator	19136933	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	17351372		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21957871, 27861908, 28711865, 30139744		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	15358862, 17189322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	12461395, 16133074, 26342701, 30342505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	24636772, 30342505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30953689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	16133074, 27798555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23840757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28722770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22692672, 31003514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21603869, 23580589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12724346, 31288452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31278358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	23602965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	23602965		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27613608, 30636880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	30139744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28716528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25892961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21603869		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30139744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30397826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30139744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30139744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12461395		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19151765		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21603869, 23580589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23580589, 32087757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12724346, 31288452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12724346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16574942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29312514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29312514		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 41	Spinocerebellar Ataxia	ORPHANET_DG	25477146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 41	Spinocerebellar Ataxia	UNIPROT_DG	25477146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 4	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar ataxia type 41	Spinocerebellar Ataxia	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylolisthesis	Spondylolisthesis	BEFREE	21311409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28012173, 28764936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31003514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35216080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29115500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	22566418		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRPC3 (transient receptor potential cation channel subfamily C member 3)