TRPC1 (transient receptor potential cation channel subfamily C member 1)

Gene

• Entrez ID: 7220
• Gene name: Transient receptor potential cation channel subfamily C member 1
• Gene symbol: TRPC1
• Synonyms (NCBI Gene): HTRP-1, TRP1
• Chromosome: 3
• Chromosome location: 3q23
• Summary: The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol se

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018877	hsa-miR-335-5p	Microarray	18185580
MIRT023057	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024528	hsa-miR-215-5p	Microarray	19074876
MIRT026862	hsa-miR-192-5p	Microarray	19074876
MIRT039618	hsa-miR-615-3p	CLASH	23622248
MIRT1457218	hsa-miR-1285	CLIP-seq
MIRT1457219	hsa-miR-3187-5p	CLIP-seq
MIRT1457220	hsa-miR-3189-3p	CLIP-seq
MIRT1457221	hsa-miR-3689a-3p	CLIP-seq
MIRT1457222	hsa-miR-3689c	CLIP-seq
MIRT1457223	hsa-miR-378g	CLIP-seq
MIRT1457224	hsa-miR-3907	CLIP-seq
MIRT1457225	hsa-miR-4314	CLIP-seq
MIRT1457226	hsa-miR-4486	CLIP-seq
MIRT1457227	hsa-miR-520d-5p	CLIP-seq
MIRT1457228	hsa-miR-524-5p	CLIP-seq
MIRT1457229	hsa-miR-543	CLIP-seq
MIRT1457230	hsa-miR-548b-3p	CLIP-seq
MIRT1457231	hsa-miR-600	CLIP-seq
MIRT1457232	hsa-miR-612	CLIP-seq
MIRT2137084	hsa-miR-4698	CLIP-seq
MIRT2137085	hsa-miR-4777-3p	CLIP-seq
MIRT2651388	hsa-miR-188-5p	CLIP-seq
MIRT2651389	hsa-miR-204	CLIP-seq
MIRT2651390	hsa-miR-211	CLIP-seq
MIRT2651391	hsa-miR-221	CLIP-seq
MIRT2651392	hsa-miR-222	CLIP-seq
MIRT2651393	hsa-miR-3123	CLIP-seq
MIRT2651394	hsa-miR-3144-3p	CLIP-seq
MIRT2651395	hsa-miR-329	CLIP-seq
MIRT2651396	hsa-miR-362-3p	CLIP-seq
MIRT2651397	hsa-miR-3653	CLIP-seq
MIRT2651398	hsa-miR-3658	CLIP-seq
MIRT2651399	hsa-miR-369-3p	CLIP-seq
MIRT2651400	hsa-miR-374a	CLIP-seq
MIRT2651401	hsa-miR-374b	CLIP-seq
MIRT2651402	hsa-miR-410	CLIP-seq
MIRT2651403	hsa-miR-4292	CLIP-seq
MIRT2651404	hsa-miR-4308	CLIP-seq
MIRT2651405	hsa-miR-4501	CLIP-seq
MIRT2651406	hsa-miR-494	CLIP-seq
MIRT2651407	hsa-miR-495	CLIP-seq
MIRT2651408	hsa-miR-570	CLIP-seq
MIRT2651409	hsa-miR-582-3p	CLIP-seq
MIRT2651410	hsa-miR-802	CLIP-seq
MIRT2651411	hsa-miR-875-3p	CLIP-seq
MIRT2651412	hsa-miR-875-5p	CLIP-seq
MIRT2651413	hsa-miR-889	CLIP-seq
MIRT2651393	hsa-miR-3123	CLIP-seq
MIRT2694211	hsa-miR-3130-3p	CLIP-seq
MIRT2651394	hsa-miR-3144-3p	CLIP-seq
MIRT2651397	hsa-miR-3653	CLIP-seq
MIRT2651398	hsa-miR-3658	CLIP-seq
MIRT2651399	hsa-miR-369-3p	CLIP-seq
MIRT2651400	hsa-miR-374a	CLIP-seq
MIRT2651401	hsa-miR-374b	CLIP-seq
MIRT1457224	hsa-miR-3907	CLIP-seq
MIRT2694212	hsa-miR-409-5p	CLIP-seq
MIRT2651402	hsa-miR-410	CLIP-seq
MIRT2651403	hsa-miR-4292	CLIP-seq
MIRT2651404	hsa-miR-4308	CLIP-seq
MIRT2651406	hsa-miR-494	CLIP-seq
MIRT2651407	hsa-miR-495	CLIP-seq
MIRT2651408	hsa-miR-570	CLIP-seq
MIRT2651409	hsa-miR-582-3p	CLIP-seq
MIRT1457231	hsa-miR-600	CLIP-seq
MIRT2651410	hsa-miR-802	CLIP-seq
MIRT2651411	hsa-miR-875-3p	CLIP-seq
MIRT2651412	hsa-miR-875-5p	CLIP-seq
MIRT2651413	hsa-miR-889	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	16709572
RELA	Unknown	16709572

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IPI	18068335
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005261	Function	Monoatomic cation channel activity	EXP	18995841
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS	8646775
GO:0005515	Function	Protein binding	IPI	10097141, 14505576, 19052258, 19193631, 19850920, 19897728, 21408196, 25114176
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14505576
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	8663995
GO:0005886	Component	Plasma membrane	TAS	7568191
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	TAS	8646775
GO:0015279	Function	Store-operated calcium channel activity	IBA
GO:0015279	Function	Store-operated calcium channel activity	IDA	8663995, 11139478, 15016832
GO:0015279	Function	Store-operated calcium channel activity	TAS	8663995
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IBA
GO:0042438	Process	Melanin biosynthetic process	IDA	8126111
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0044325	Function	Transmembrane transporter binding	IPI	10097141
GO:0046872	Function	Metal ion binding	IEA
GO:0051117	Function	ATPase binding	IPI	18068335
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	19052258
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	19052258
GO:0051592	Process	Response to calcium ion	IDA	14505576, 19052258
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IBA
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IDA	14505576
GO:1903779	Process	Regulation of cardiac conduction	TAS

Other IDs

• MIM: 602343
• HGNC: 12333
• e!Ensembl: ENSG00000144935

Protein

• UniProt ID: P48995
• Protein name: Short transient receptor potential channel 1 (TrpC1) (Transient receptor protein 1) (TRP-1)
• Protein function: Forms a receptor-activated non-selective calcium permeant cation channel (PubMed:11139478, PubMed:15016832, PubMed:39478185). Forms a heteromeric ion channel with TRPC4 or TRPC5 that has reduced calcium permeability compared to the homomeric TRP
• PDB: 8WPL, 8WPM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08344	TRP_2	193 → 255	Transient receptor ion channel II	Family
  PF00520	Ion_trans	391 → 657	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Seems to be ubiquitous.
• Sequence:

  MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
  YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDS
  EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK
  QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
  SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL
  LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF
  WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL
  ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF
  HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF
  LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS
  LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW
  KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW
  RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG
  FRTSKYAMFYPRN

• Sequence length: 793

Pathways

KEGG:

Axon guidance
Glutamatergic synapse
Serotonergic synapse
GnRH secretion
Pancreatic secretion

Reactome:

TRP channels
Ion homeostasis
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	22273362, 34697589	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28756533		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28931396		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20187291	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28756533		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30954598		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10587362		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	30504729		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19332022, 27183905, 28559303		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22666335, 27183905, 38308220	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27793015	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27443843	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23840757		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35887266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24603752	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26647723		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28583863		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28583863	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30504729		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27499044, 31014395		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29068985		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16231315, 31203007		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25143380	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25143380	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17382525, 30423318		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23544998	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23544998	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23544998	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18802326, 23544998, 29074621		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23544998	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18184923, 18802326, 19546862, 23544998		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	18184923		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29373286		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34337010, 34936030, 35754147	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30134548	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34697589	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	33877007	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	17189322	Associate	★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	26280213		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	26280213		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26088448	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18211288, 21506118, 23261316, 39189437	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20544850, 21506118		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17382525, 30423318		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26133660		★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	17189322		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	16899508		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30423318		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	10587362		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20003325, 35186183	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30266526, 30468677		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17189322		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	9165220		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	BEFREE	16899508		★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	16899508, 18049860		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28949388		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34999117	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25535724, 25960236		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	11158974, 12060571	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19215795		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19332022, 27183905, 28559303		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23840757		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26647723		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12724346		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29570903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25971967		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22920441, 26647723, 31203007		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16231315, 31203007		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10080955, 10587362, 10620110, 15214892, 1769662, 21152437, 30397036, 7667256		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19287070	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29074621		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28756533		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	10080955, 30849679		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28578393		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28578393	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	8431915		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22367186		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21499127, 21907124, 22178934, 26647723, 30397036		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	15542611	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22446186, 29150520		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23840757		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29074621, 29989850		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26647723		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20861471	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	15542611	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22446186, 28258168, 28545724		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12724346		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12724346	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30468677		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29068985	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32319532, 37654522	Stimulate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24908566		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18172497		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29634917		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	29660945		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29570903		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28183357		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25971967		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25971967		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25971967	Associate	★☆☆☆☆ Found in Text Mining only
Trichorhinophalangeal Syndrome, Type III	Trichorhinophalangeal Dysplasia	BEFREE	10405449		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31230251		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28791397		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28791397	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	12855710	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	11167683		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	11167683		★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome	Waardenburg syndrome	Pubtator	10536986	Associate	★☆☆☆☆ Found in Text Mining only