TRIP6 (thyroid hormone receptor interactor 6)

Gene

• Entrez ID: 7205
• Gene name: Thyroid hormone receptor interactor 6
• Gene symbol: TRIP6
• Synonyms (NCBI Gene): OIP-1, OIP1, TRIP-6, TRIP6i2, ZRP-1
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphati

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030281	hsa-miR-26b-5p	Microarray	19088304
MIRT045504	hsa-miR-149-5p	CLASH	23622248
MIRT042285	hsa-miR-484	CLASH	23622248
MIRT1456653	hsa-miR-1253	CLIP-seq
MIRT1456654	hsa-miR-1270	CLIP-seq
MIRT1456655	hsa-miR-4310	CLIP-seq
MIRT1456656	hsa-miR-4311	CLIP-seq
MIRT1456657	hsa-miR-4434	CLIP-seq
MIRT1456658	hsa-miR-4516	CLIP-seq
MIRT1456659	hsa-miR-4531	CLIP-seq
MIRT1456660	hsa-miR-4795-3p	CLIP-seq
MIRT1456661	hsa-miR-509-3p	CLIP-seq
MIRT1456662	hsa-miR-526b	CLIP-seq
MIRT1456663	hsa-miR-578	CLIP-seq
MIRT1456664	hsa-miR-620	CLIP-seq
MIRT2136855	hsa-miR-1245	CLIP-seq
MIRT1456653	hsa-miR-1253	CLIP-seq
MIRT1456654	hsa-miR-1270	CLIP-seq
MIRT2136856	hsa-miR-2392	CLIP-seq
MIRT2136857	hsa-miR-3165	CLIP-seq
MIRT2136858	hsa-miR-3691-5p	CLIP-seq
MIRT2136859	hsa-miR-4270	CLIP-seq
MIRT1456655	hsa-miR-4310	CLIP-seq
MIRT1456656	hsa-miR-4311	CLIP-seq
MIRT1456657	hsa-miR-4434	CLIP-seq
MIRT2136860	hsa-miR-4441	CLIP-seq
MIRT2136861	hsa-miR-4504	CLIP-seq
MIRT1456658	hsa-miR-4516	CLIP-seq
MIRT1456659	hsa-miR-4531	CLIP-seq
MIRT2136862	hsa-miR-4693-3p	CLIP-seq
MIRT2136863	hsa-miR-4705	CLIP-seq
MIRT2136864	hsa-miR-4764-5p	CLIP-seq
MIRT2136865	hsa-miR-4765	CLIP-seq
MIRT2136866	hsa-miR-485-3p	CLIP-seq
MIRT1456661	hsa-miR-509-3p	CLIP-seq
MIRT2136867	hsa-miR-552	CLIP-seq
MIRT1456664	hsa-miR-620	CLIP-seq
MIRT2136855	hsa-miR-1245	CLIP-seq
MIRT2136857	hsa-miR-3165	CLIP-seq
MIRT2136858	hsa-miR-3691-5p	CLIP-seq
MIRT2136859	hsa-miR-4270	CLIP-seq
MIRT2136860	hsa-miR-4441	CLIP-seq
MIRT2136862	hsa-miR-4693-3p	CLIP-seq
MIRT2136863	hsa-miR-4705	CLIP-seq
MIRT2136864	hsa-miR-4764-5p	CLIP-seq
MIRT2136865	hsa-miR-4765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IBA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005149	Function	Interleukin-1 receptor binding	IDA	15657077
GO:0005515	Function	Protein binding	IPI	10826496, 11782456, 14688263, 15657077, 16137684, 16189514, 16713569, 16880273, 19060904, 21516116, 23088713, 25416956, 25910212, 26871637, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	10826496
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IDA	16624523
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	14688263
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0019900	Function	Kinase binding	IPI	15657077
GO:0030335	Process	Positive regulation of cell migration	IMP	14688263
GO:0043009	Process	Chordate embryonic development	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046966	Function	Nuclear thyroid hormone receptor binding	NAS	9598321
GO:0048041	Process	Focal adhesion assembly	NAS	14688263
GO:0070161	Component	Anchoring junction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IBA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	15657077

Other IDs

• MIM: 602933
• HGNC: 12311
• e!Ensembl: ENSG00000087077

Protein

• UniProt ID: Q15654
• Protein name: Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1)
• Protein function: Relays signals from the cell surface to the nucleus to weaken adherens junction and promote actin cytoskeleton reorganization and cell invasiveness. Involved in lysophosphatidic acid-induced cell adhesion and migration. Acts as a transcriptional
• PDB: 1X61, 2DLO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	279 → 336	LIM domain	Domain
  PF00412	LIM	339 → 395	LIM domain	Domain
  PF00412	LIM	399 → 464	LIM domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Abundantly expressed in kidney, liver and lung. Lower levels in heart, placenta and pancreas. Expressed in colonic epithelial cells. Up-regulated in colonic tumors. {ECO:0000269|PubMed:19017743}.
• Sequence:

  MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
  PEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
  QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRG
  CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGG
  EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
  HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
  GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
  LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

• Sequence length: 476

Pathways

KEGG:

NOD-like receptor signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	36833223	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	23576104		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19017743		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37524774, 38238555	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31029422		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24033704		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20876301, 23339869		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23339869		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30061182	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29080747		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	23576104		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22054418		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23313295		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23576104		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23576104	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	23576104	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22054418, 31018940		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15345369		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	18348201		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	18348201		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	31595394	Associate	★☆☆☆☆ Found in Text Mining only