TRH (thyrotropin releasing hormone)

Gene

• Entrez ID: 7200
• Gene name: Thyrotropin releasing hormone
• Gene symbol: TRH
• Synonyms (NCBI Gene): Pro-TRH, TRF
• Chromosome: 3
• Chromosome location: 3q22.1
• Summary: This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1452491	hsa-miR-1343	CLIP-seq
MIRT1452492	hsa-miR-3151	CLIP-seq
MIRT1452493	hsa-miR-4257	CLIP-seq
MIRT1452494	hsa-miR-4447	CLIP-seq
MIRT1452495	hsa-miR-4472	CLIP-seq
MIRT1452496	hsa-miR-4476	CLIP-seq
MIRT1452497	hsa-miR-4533	CLIP-seq
MIRT1452498	hsa-miR-4650-5p	CLIP-seq
MIRT1452499	hsa-miR-4670-3p	CLIP-seq
MIRT1452500	hsa-miR-4690-5p	CLIP-seq
MIRT1452501	hsa-miR-4790-3p	CLIP-seq
MIRT1452502	hsa-miR-4797-5p	CLIP-seq
MIRT1452503	hsa-miR-486-3p	CLIP-seq
MIRT1452504	hsa-miR-541	CLIP-seq
MIRT1452505	hsa-miR-637	CLIP-seq
MIRT1452506	hsa-miR-654-5p	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq
MIRT2356657	hsa-miR-188-3p	CLIP-seq
MIRT2356658	hsa-miR-3591-3p	CLIP-seq
MIRT2356659	hsa-miR-4729	CLIP-seq
MIRT2356660	hsa-miR-4733-5p	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2462305	hsa-miR-4728-5p	CLIP-seq
MIRT2462306	hsa-miR-4755-3p	CLIP-seq
MIRT2462307	hsa-miR-671-5p	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2462305	hsa-miR-4728-5p	CLIP-seq
MIRT2462306	hsa-miR-4755-3p	CLIP-seq
MIRT2462307	hsa-miR-671-5p	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq
MIRT2135500	hsa-miR-2110	CLIP-seq
MIRT2135501	hsa-miR-3150a-3p	CLIP-seq
MIRT2135502	hsa-miR-3175	CLIP-seq
MIRT2462305	hsa-miR-4728-5p	CLIP-seq
MIRT2462306	hsa-miR-4755-3p	CLIP-seq
MIRT2462307	hsa-miR-671-5p	CLIP-seq
MIRT2135503	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	11134186;9827656
STAT3	Unknown	11134186

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001692	Process	Histamine metabolic process	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	TAS	2126343
GO:0007267	Process	Cell-cell signaling	TAS	2126343
GO:0007628	Process	Adult walking behavior	IEA
GO:0008437	Function	Thyrotropin-releasing hormone activity	IBA
GO:0008437	Function	Thyrotropin-releasing hormone activity	IEA
GO:0008437	Function	Thyrotropin-releasing hormone activity	TAS	2126343
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IBA
GO:0014054	Process	Positive regulation of gamma-aminobutyric acid secretion	IBA
GO:0030141	Component	Secretory granule	IBA
GO:0032024	Process	Positive regulation of insulin secretion	IBA
GO:0042755	Process	Eating behavior	IBA

Other IDs

• MIM: 613879
• HGNC: 12298
• e!Ensembl: ENSG00000170893

Protein

• UniProt ID: P20396
• Protein name: Pro-thyrotropin-releasing hormone (Pro-TRH) (Prothyroliberin) [Cleaved into: Thyrotropin-releasing hormone (TRH) (Protirelin) (TSH-releasing factor) (Thyroliberin) (Thyrotropin-releasing factor) (TRF)]
• Protein function: As a component of the hypothalamic-pituitary-thyroid axis, it controls the secretion of thyroid-stimulating hormone (TSH) and is involved in thyroid hormone synthesis regulation. It also operates as modulator of hair growth. It promotes hair-sha
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05438	TRH	6 → 206	Thyrotropin-releasing hormone (TRH)	Family

• Tissue specificity: TISSUE SPECIFICITY: Hypothalamus. Expressed in the hair follicle epithelium (at protein level). {ECO:0000269|PubMed:19825978}.
• Sequence:

  MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQ
  RLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRRE
  DEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDL
  MPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
  EE

• Sequence length: 242

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMIAS, CARDIAC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothalamic hypothyroidism	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRH-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	24111551		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	18206229		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	18206229		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10946869, 11209812, 11327621, 12067454, 14599121, 7758228, 8396925, 8729534		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	15326569		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	8405091		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	16774812		★☆☆☆☆ Found in Text Mining only
Allan-Herndon-Dudley syndrome (AHDS)	Allan-Herndon-Dudley Syndrome	BEFREE	20713192		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	CTD_human_DG	7562510, 7617693, 8405091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	27864049		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27864049		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	35964359	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10974663		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26799787, 31165277		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29343961		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29343961		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17301820		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19519292, 25362934, 29935915, 30593422		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25362934	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22610075, 25332168	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22491060	Associate	★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	2547386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	24706429		★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	BEFREE	20016054, 21274321, 28324000, 29794369		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17301820		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	1401747		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Coma, Post-Traumatic, Prolonged	Coma	CTD_human_DG	8690305		★☆☆☆☆ Found in Text Mining only
Combined Pituitary Hormone Deficiency	Combined pituitary hormone deficiency	Pubtator	9745452	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Congenital central hypothyroidism	Congenital Central Hypothyroidism	BEFREE	23363888		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	782770		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29376041		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29142423		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19078951, 25028079, 2543997, 6412261, 7798461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	2543997, 6412261, 7798461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17666463, 28236320		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28236320		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25362934		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25362934	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28419241		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30555300		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	15328193		★☆☆☆☆ Found in Text Mining only
Endemic Cretinism	Endemic Cretinism	BEFREE	782770		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29693365	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	8603636		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	9673357		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	9673357		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	15131262, 16445164, 19299458, 21870171, 24165508, 31326901, 9430820, 9737363, 9827656		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10974663		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10974663		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	122407, 6774999		★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	11209812		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	1401747		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30286449		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	6808452		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11566956, 17137217, 29674333, 30052747, 9323019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	6350720		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	37876543	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	6774999		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	6436075		★☆☆☆☆ Found in Text Mining only
Hypothalamic hypothyroidism	Hypothalamic hypothyroidism	BEFREE	18418668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothalamic hypothyroidism	Hypothalamic hypothyroidism	ORPHANET_DG	20687402		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothalamic hypothyroidism	Hypothalamic hypothyroidism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	15328193, 15671099, 17526952, 30590076, 487612, 628396, 6774999, 6792914, 6808452		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	26735259	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28821377		★☆☆☆☆ Found in Text Mining only
Isolated thyrotropin-releasing hormone deficiency	Isolated Thyrotropin-Releasing Hormone Deficiency	Orphanet			★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	8405091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	8405091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	8405091		★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	22665330		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36291567, 37027440, 37798266	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	18206229		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29124350		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	1401747		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20565977	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	7798461		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19519292, 25362934, 29935915, 30593422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	9673357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21723258		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29935915		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28324000		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	27721186		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15328193		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15328193		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18418668, 2543997, 6412261, 7798461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	18418668, 19078951, 25028079, 2543997, 7798461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	6412261		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	17049485	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	38402855	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	26683872	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9118038		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	CTD_human_DG	2845442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	CTD_human_DG	2845442		★☆☆☆☆ Found in Text Mining only
Narcosis	Narcosis	CTD_human_DG	416961, 8690305		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17301820, 24111551, 7758228		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8166684, 9430820, 9827656		★☆☆☆☆ Found in Text Mining only
Nicolaides Baraitser syndrome	Nicolaides Baraitser Syndrome	BEFREE	11448772		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	11448772		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25449029, 31639326		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21723258		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30555300, 30618632		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	4632689		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	14599121		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	LHGDN	18805917		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	CTD_human_DG	1305443, 1833029		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	18000138		★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	BEFREE	21274321		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	26683872		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30081853	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	30081853		★☆☆☆☆ Found in Text Mining only
Stupor	Stupor	CTD_human_DG	416961, 8690305		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30660483		★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	10405448, 28821377, 29057835, 6792914		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	31645528		★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	19299458, 7528740	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid Hormone Resistance	BEFREE	9430820, 9827656		★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	6187257		★☆☆☆☆ Found in Text Mining only
Thyrotroph adenoma	Adenoma	BEFREE	25040256		★☆☆☆☆ Found in Text Mining only
THYROTROPIN-RELEASING HORMONE DEFICIENCY	Hypothalamic hypothyroidism	ORPHANET_DG	20687402		★☆☆☆☆ Found in Text Mining only
THYROTROPIN-RELEASING HORMONE DEFICIENCY	Hypothalamic hypothyroidism	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	9430820		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	6418677, 6461684, 7798461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	6461684, 7798461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	31293518		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	10443546, 15781040		★☆☆☆☆ Found in Text Mining only