HSP90B1 (heat shock protein 90 beta family member 1)

Gene

• Entrez ID: 7184
• Gene name: Heat shock protein 90 beta family member 1
• Gene symbol: HSP90B1
• Synonyms (NCBI Gene): ECGP, GP96, GRP94, HEL-S-125m, HEL35, TRA1
• Chromosome: 12
• Chromosome location: 12q23.3
• Summary: This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003874	hsa-miR-15a-5p	Microarray	18362358
MIRT004368	hsa-miR-16-5p	Microarray	18362358
MIRT004158	hsa-miR-192-5p	Microarray	16822819
MIRT007086	hsa-miR-223-3p	Luciferase reporter assay	23208072
MIRT007086	hsa-miR-223-3p	Luciferase reporter assay	23208072
MIRT017651	hsa-miR-335-5p	Microarray	18185580
MIRT020159	hsa-miR-130b-3p	Sequencing	20371350
MIRT023707	hsa-miR-1-3p	Proteomics	18668040
MIRT025974	hsa-miR-148a-3p	Sequencing	20371350
MIRT049100	hsa-miR-92a-3p	CLASH	23622248
MIRT045853	hsa-miR-128-3p	CLASH	23622248
MIRT041729	hsa-miR-484	CLASH	23622248
MIRT041729	hsa-miR-484	CLASH	23622248
MIRT023707	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT523132	hsa-miR-206	PAR-CLIP	20371350
MIRT523131	hsa-miR-613	PAR-CLIP	20371350
MIRT523130	hsa-miR-433-3p	PAR-CLIP	20371350
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT523126	hsa-miR-4262	PAR-CLIP	20371350
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT523124	hsa-miR-4272	PAR-CLIP	20371350
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	20371350
MIRT523121	hsa-miR-3915	PAR-CLIP	20371350
MIRT023707	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT523132	hsa-miR-206	PAR-CLIP	20371350
MIRT523131	hsa-miR-613	PAR-CLIP	20371350
MIRT523130	hsa-miR-433-3p	PAR-CLIP	20371350
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT523126	hsa-miR-4262	PAR-CLIP	20371350
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT523124	hsa-miR-4272	PAR-CLIP	20371350
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	20371350
MIRT523121	hsa-miR-3915	PAR-CLIP	20371350
MIRT023707	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT523132	hsa-miR-206	PAR-CLIP	20371350
MIRT523131	hsa-miR-613	PAR-CLIP	20371350
MIRT523130	hsa-miR-433-3p	PAR-CLIP	20371350
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT523126	hsa-miR-4262	PAR-CLIP	20371350
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT523124	hsa-miR-4272	PAR-CLIP	20371350
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	20371350
MIRT523121	hsa-miR-3915	PAR-CLIP	20371350
MIRT475512	hsa-miR-302f	PAR-CLIP	20371350
MIRT475509	hsa-miR-3123	PAR-CLIP	20371350
MIRT475507	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT475506	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT475502	hsa-miR-3919	PAR-CLIP	20371350
MIRT475498	hsa-miR-6125	PAR-CLIP	20371350
MIRT475495	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT475491	hsa-miR-658	PAR-CLIP	20371350
MIRT475489	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT475488	hsa-miR-1273e	PAR-CLIP	20371350
MIRT023707	hsa-miR-1-3p	PAR-CLIP	23446348
MIRT523132	hsa-miR-206	PAR-CLIP	23446348
MIRT523131	hsa-miR-613	PAR-CLIP	23446348
MIRT523130	hsa-miR-433-3p	PAR-CLIP	23446348
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	23446348
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	23446348
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	23446348
MIRT523126	hsa-miR-4262	PAR-CLIP	23446348
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	23446348
MIRT523124	hsa-miR-4272	PAR-CLIP	23446348
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	23446348
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	23446348
MIRT523121	hsa-miR-3915	PAR-CLIP	23446348
MIRT475512	hsa-miR-302f	PAR-CLIP	23592263
MIRT475511	hsa-miR-512-5p	PAR-CLIP	23592263
MIRT475510	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT475509	hsa-miR-3123	PAR-CLIP	23592263
MIRT475508	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT475507	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT475506	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT475505	hsa-miR-3929	PAR-CLIP	23592263
MIRT475504	hsa-miR-4419b	PAR-CLIP	23592263
MIRT475503	hsa-miR-4478	PAR-CLIP	23592263
MIRT475502	hsa-miR-3919	PAR-CLIP	23592263
MIRT475501	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT475499	hsa-miR-4459	PAR-CLIP	23592263
MIRT475500	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT475498	hsa-miR-6125	PAR-CLIP	23592263
MIRT475497	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT475496	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT475495	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT475494	hsa-miR-1827	PAR-CLIP	23592263
MIRT475493	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT475492	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT475491	hsa-miR-658	PAR-CLIP	23592263
MIRT475490	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT475489	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT475488	hsa-miR-1273e	PAR-CLIP	23592263
MIRT475487	hsa-miR-665	PAR-CLIP	23592263
MIRT440482	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440482	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT007086	hsa-miR-223-3p	Luciferase reporter assay, Western blot	25880332
MIRT007086	hsa-miR-223-3p	Luciferase reporter assay, Western blot	25880332
MIRT007086	hsa-miR-223-3p	Luciferase reporter assay, Western blot	25880332
MIRT007086	hsa-miR-223-3p	Luciferase reporter assay, Western blot	25880332
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT025974	hsa-miR-148a-3p	PAR-CLIP	26701625
MIRT475488	hsa-miR-1273e	PAR-CLIP	27292025
MIRT475495	hsa-miR-219b-3p	PAR-CLIP	27292025
MIRT475489	hsa-miR-25-5p	PAR-CLIP	27292025
MIRT475512	hsa-miR-302f	PAR-CLIP	27292025
MIRT475498	hsa-miR-6125	PAR-CLIP	27292025
MIRT475491	hsa-miR-658	PAR-CLIP	27292025
MIRT023707	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT523132	hsa-miR-206	PAR-CLIP	20371350
MIRT523131	hsa-miR-613	PAR-CLIP	20371350
MIRT523130	hsa-miR-433-3p	PAR-CLIP	20371350
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT523126	hsa-miR-4262	PAR-CLIP	20371350
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT523124	hsa-miR-4272	PAR-CLIP	20371350
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	20371350
MIRT523121	hsa-miR-3915	PAR-CLIP	20371350
MIRT023707	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT523132	hsa-miR-206	PAR-CLIP	20371350
MIRT523131	hsa-miR-613	PAR-CLIP	20371350
MIRT523130	hsa-miR-433-3p	PAR-CLIP	20371350
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT523126	hsa-miR-4262	PAR-CLIP	20371350
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT523124	hsa-miR-4272	PAR-CLIP	20371350
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	20371350
MIRT523121	hsa-miR-3915	PAR-CLIP	20371350
MIRT023707	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT523132	hsa-miR-206	PAR-CLIP	20371350
MIRT523131	hsa-miR-613	PAR-CLIP	20371350
MIRT523130	hsa-miR-433-3p	PAR-CLIP	20371350
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT523126	hsa-miR-4262	PAR-CLIP	20371350
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT523124	hsa-miR-4272	PAR-CLIP	20371350
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	20371350
MIRT523121	hsa-miR-3915	PAR-CLIP	20371350
MIRT475512	hsa-miR-302f	PAR-CLIP	20371350
MIRT475509	hsa-miR-3123	PAR-CLIP	20371350
MIRT475507	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT475506	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT475502	hsa-miR-3919	PAR-CLIP	20371350
MIRT475498	hsa-miR-6125	PAR-CLIP	20371350
MIRT475495	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT475491	hsa-miR-658	PAR-CLIP	20371350
MIRT475489	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT475488	hsa-miR-1273e	PAR-CLIP	20371350
MIRT023707	hsa-miR-1-3p	PAR-CLIP	23446348
MIRT523132	hsa-miR-206	PAR-CLIP	23446348
MIRT523131	hsa-miR-613	PAR-CLIP	23446348
MIRT523130	hsa-miR-433-3p	PAR-CLIP	23446348
MIRT523129	hsa-miR-181c-5p	PAR-CLIP	23446348
MIRT523128	hsa-miR-181a-5p	PAR-CLIP	23446348
MIRT523127	hsa-miR-181d-5p	PAR-CLIP	23446348
MIRT523126	hsa-miR-4262	PAR-CLIP	23446348
MIRT523125	hsa-miR-181b-5p	PAR-CLIP	23446348
MIRT523124	hsa-miR-4272	PAR-CLIP	23446348
MIRT523123	hsa-miR-3928-3p	PAR-CLIP	23446348
MIRT523122	hsa-miR-7154-5p	PAR-CLIP	23446348
MIRT523121	hsa-miR-3915	PAR-CLIP	23446348
MIRT475512	hsa-miR-302f	PAR-CLIP	23592263
MIRT475511	hsa-miR-512-5p	PAR-CLIP	23592263
MIRT475510	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT475509	hsa-miR-3123	PAR-CLIP	23592263
MIRT475508	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT475507	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT475506	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT475505	hsa-miR-3929	PAR-CLIP	23592263
MIRT475504	hsa-miR-4419b	PAR-CLIP	23592263
MIRT475503	hsa-miR-4478	PAR-CLIP	23592263
MIRT475502	hsa-miR-3919	PAR-CLIP	23592263
MIRT475501	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT475499	hsa-miR-4459	PAR-CLIP	23592263
MIRT475500	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT475498	hsa-miR-6125	PAR-CLIP	23592263
MIRT475497	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT475496	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT475495	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT475494	hsa-miR-1827	PAR-CLIP	23592263
MIRT475493	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT475492	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT475491	hsa-miR-658	PAR-CLIP	23592263
MIRT475490	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT475489	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT475488	hsa-miR-1273e	PAR-CLIP	23592263
MIRT475487	hsa-miR-665	PAR-CLIP	23592263
MIRT1055890	hsa-miR-148a	CLIP-seq
MIRT1055891	hsa-miR-148b	CLIP-seq
MIRT1055892	hsa-miR-150	CLIP-seq
MIRT1055893	hsa-miR-152	CLIP-seq
MIRT1055894	hsa-miR-188-3p	CLIP-seq
MIRT1055895	hsa-miR-1909	CLIP-seq
MIRT1055896	hsa-miR-1914	CLIP-seq
MIRT1055897	hsa-miR-23a	CLIP-seq
MIRT1055898	hsa-miR-23b	CLIP-seq
MIRT1055899	hsa-miR-23c	CLIP-seq
MIRT1055900	hsa-miR-3122	CLIP-seq
MIRT1055901	hsa-miR-3171	CLIP-seq
MIRT1055902	hsa-miR-3913-5p	CLIP-seq
MIRT1055903	hsa-miR-3938	CLIP-seq
MIRT1055904	hsa-miR-4495	CLIP-seq
MIRT1055905	hsa-miR-450b-3p	CLIP-seq
MIRT1055906	hsa-miR-4643	CLIP-seq
MIRT1055907	hsa-miR-466	CLIP-seq
MIRT1055908	hsa-miR-4661-3p	CLIP-seq
MIRT1055909	hsa-miR-4693-3p	CLIP-seq
MIRT1055910	hsa-miR-4710	CLIP-seq
MIRT1055911	hsa-miR-4713-3p	CLIP-seq
MIRT1055912	hsa-miR-4713-5p	CLIP-seq
MIRT1055913	hsa-miR-4789-3p	CLIP-seq
MIRT1055914	hsa-miR-4789-5p	CLIP-seq
MIRT1055915	hsa-miR-4792	CLIP-seq
MIRT1055916	hsa-miR-513a-3p	CLIP-seq
MIRT1055917	hsa-miR-522	CLIP-seq
MIRT1055918	hsa-miR-532-3p	CLIP-seq
MIRT1055919	hsa-miR-638	CLIP-seq
MIRT1055920	hsa-miR-642a	CLIP-seq
MIRT1055921	hsa-miR-769-3p	CLIP-seq
MIRT1055890	hsa-miR-148a	CLIP-seq
MIRT1055891	hsa-miR-148b	CLIP-seq
MIRT1055893	hsa-miR-152	CLIP-seq
MIRT1055895	hsa-miR-1909	CLIP-seq
MIRT1055894	hsa-miR-188-3p	CLIP-seq
MIRT2245156	hsa-miR-181a	CLIP-seq
MIRT2245157	hsa-miR-181b	CLIP-seq
MIRT2245158	hsa-miR-181c	CLIP-seq
MIRT2245159	hsa-miR-181d	CLIP-seq
MIRT1055894	hsa-miR-188-3p	CLIP-seq
MIRT1055896	hsa-miR-1914	CLIP-seq
MIRT2245160	hsa-miR-223	CLIP-seq
MIRT1055897	hsa-miR-23a	CLIP-seq
MIRT1055898	hsa-miR-23b	CLIP-seq
MIRT1055899	hsa-miR-23c	CLIP-seq
MIRT2245161	hsa-miR-3074-5p	CLIP-seq
MIRT2245162	hsa-miR-3121-3p	CLIP-seq
MIRT1055903	hsa-miR-3938	CLIP-seq
MIRT2245163	hsa-miR-433	CLIP-seq
MIRT1055904	hsa-miR-4495	CLIP-seq
MIRT1055908	hsa-miR-4661-3p	CLIP-seq
MIRT2245164	hsa-miR-499-3p	CLIP-seq
MIRT2245165	hsa-miR-499a-3p	CLIP-seq
MIRT1055916	hsa-miR-513a-3p	CLIP-seq
MIRT1055920	hsa-miR-642a	CLIP-seq
MIRT2245166	hsa-miR-935	CLIP-seq
MIRT2245160	hsa-miR-223	CLIP-seq
MIRT2245164	hsa-miR-499-3p	CLIP-seq
MIRT2245165	hsa-miR-499a-3p	CLIP-seq
MIRT2245166	hsa-miR-935	CLIP-seq
MIRT2548076	hsa-miR-1	CLIP-seq
MIRT1055890	hsa-miR-148a	CLIP-seq
MIRT1055891	hsa-miR-148b	CLIP-seq
MIRT1055892	hsa-miR-150	CLIP-seq
MIRT1055893	hsa-miR-152	CLIP-seq
MIRT2245156	hsa-miR-181a	CLIP-seq
MIRT2245157	hsa-miR-181b	CLIP-seq
MIRT2245158	hsa-miR-181c	CLIP-seq
MIRT2245159	hsa-miR-181d	CLIP-seq
MIRT1055894	hsa-miR-188-3p	CLIP-seq
MIRT1055895	hsa-miR-1909	CLIP-seq
MIRT2245160	hsa-miR-223	CLIP-seq
MIRT1055897	hsa-miR-23a	CLIP-seq
MIRT1055898	hsa-miR-23b	CLIP-seq
MIRT1055899	hsa-miR-23c	CLIP-seq
MIRT2245162	hsa-miR-3121-3p	CLIP-seq
MIRT1055901	hsa-miR-3171	CLIP-seq
MIRT2548077	hsa-miR-3928	CLIP-seq
MIRT2245163	hsa-miR-433	CLIP-seq
MIRT1055904	hsa-miR-4495	CLIP-seq
MIRT1055912	hsa-miR-4713-5p	CLIP-seq
MIRT2245164	hsa-miR-499-3p	CLIP-seq
MIRT2245165	hsa-miR-499a-3p	CLIP-seq
MIRT1055916	hsa-miR-513a-3p	CLIP-seq
MIRT1055918	hsa-miR-532-3p	CLIP-seq
MIRT2548078	hsa-miR-548ac	CLIP-seq
MIRT2548079	hsa-miR-548d-3p	CLIP-seq
MIRT2548080	hsa-miR-548z	CLIP-seq
MIRT2245166	hsa-miR-935	CLIP-seq
MIRT2548076	hsa-miR-1	CLIP-seq
MIRT1055890	hsa-miR-148a	CLIP-seq
MIRT1055891	hsa-miR-148b	CLIP-seq
MIRT1055892	hsa-miR-150	CLIP-seq
MIRT1055893	hsa-miR-152	CLIP-seq
MIRT2245156	hsa-miR-181a	CLIP-seq
MIRT2245157	hsa-miR-181b	CLIP-seq
MIRT2245158	hsa-miR-181c	CLIP-seq
MIRT2245159	hsa-miR-181d	CLIP-seq
MIRT1055894	hsa-miR-188-3p	CLIP-seq
MIRT1055895	hsa-miR-1909	CLIP-seq
MIRT1055896	hsa-miR-1914	CLIP-seq
MIRT2245160	hsa-miR-223	CLIP-seq
MIRT1055897	hsa-miR-23a	CLIP-seq
MIRT1055898	hsa-miR-23b	CLIP-seq
MIRT1055899	hsa-miR-23c	CLIP-seq
MIRT2245161	hsa-miR-3074-5p	CLIP-seq
MIRT2245162	hsa-miR-3121-3p	CLIP-seq
MIRT1055901	hsa-miR-3171	CLIP-seq
MIRT2548077	hsa-miR-3928	CLIP-seq
MIRT2245163	hsa-miR-433	CLIP-seq
MIRT1055904	hsa-miR-4495	CLIP-seq
MIRT1055912	hsa-miR-4713-5p	CLIP-seq
MIRT2245164	hsa-miR-499-3p	CLIP-seq
MIRT2245165	hsa-miR-499a-3p	CLIP-seq
MIRT1055916	hsa-miR-513a-3p	CLIP-seq
MIRT1055918	hsa-miR-532-3p	CLIP-seq
MIRT2548078	hsa-miR-548ac	CLIP-seq
MIRT2548079	hsa-miR-548d-3p	CLIP-seq
MIRT2548080	hsa-miR-548z	CLIP-seq
MIRT2245166	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001666	Process	Response to hypoxia	IDA	15620698
GO:0003723	Function	RNA binding	IDA	11958450
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	19000834
GO:0005509	Function	Calcium ion binding	TAS	10497210
GO:0005515	Function	Protein binding	IPI	9596688, 11907036, 11958450, 15845869, 18264092, 23349634, 23995768, 26496610, 30021884, 32812023, 32814053, 35063084
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17344063, 30188326
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	16130169
GO:0005788	Component	Endoplasmic reticulum lumen	IDA	10497210
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	10497210
GO:0005790	Component	Smooth endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	9596688
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	23572575
GO:0006457	Process	Protein folding	IEA
GO:0015031	Process	Protein transport	NAS	15845869
GO:0016020	Component	Membrane	HDA	19946888
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019903	Function	Protein phosphatase binding	IDA	19000834
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IDA	23572575, 39509507
GO:0030496	Component	Midbody	IDA	15166316
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IMP	25660456
GO:0031247	Process	Actin rod assembly	IDA	19000834
GO:0032991	Component	Protein-containing complex	IDA	23349634
GO:0033018	Component	Sarcoplasmic reticulum lumen	IEA
GO:0034123	Process	Positive regulation of toll-like receptor signaling pathway	IDA	11584270
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IEA
GO:0034975	Process	Protein folding in endoplasmic reticulum	TAS	22013210
GO:0034976	Process	Response to endoplasmic reticulum stress	TAS	22934019
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IDA	24899641
GO:0036503	Process	ERAD pathway	IMP	18264092
GO:0042470	Component	Melanosome	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10497210, 15192333
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0044183	Function	Protein folding chaperone	IDA	11584270, 39509507
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10497210
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IDA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051208	Process	Sequestering of calcium ion	NAS	15192333
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337
GO:0071287	Process	Cellular response to manganese ion	IEA
GO:0071318	Process	Cellular response to ATP	IDA	19000834
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0072659	Process	Protein localization to plasma membrane	IDA	23572575
GO:0097524	Component	Sperm plasma membrane	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IDA	23572575
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA

Other IDs

• MIM: 191175
• HGNC: 12028
• e!Ensembl: ENSG00000166598

Protein

• UniProt ID: P14625
• Protein name: Endoplasmin (EC 3.6.4.-) (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Heat shock protein family C member 4) (Tumor rejection antigen 1) (gp96 homolog)
• Protein function: ATP-dependent chaperone involved in the processing of proteins in the endoplasmic reticulum, regulating their transport (PubMed:23572575, PubMed:39509507). Together with MESD, acts as a modulator of the Wnt pathway by promoting the folding of LR
• PDB: 4NH9, 7ULL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02518	HATPase_c	96 → 255	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
  PF00183	HSP90	257 → 781	Hsp90 protein	Family

• Sequence:

  MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
  LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
  TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
  AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
  LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
  EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
  SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
  DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
  NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
  MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
  SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
  IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
  ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDE
  EMDVGTDEEEETAKESTAEKDEL

• Sequence length: 803

Pathways

KEGG:

Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
IL-17 signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Salmonella infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Prostate cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Trafficking and processing of endosomal TLR
Scavenging by Class A Receptors
ATF6 (ATF6-alpha) activates chaperone genes
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Interleukin-4 and Interleukin-13 signaling
Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11756233, 18331622, 20090101		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18331622		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	26910913		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36291587	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	27889204		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28822264		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28822264		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	11331263		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20352117, 24816397, 28561043		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24816397, 33542414	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28748446		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11756233		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	17805476, 18771604, 19125190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17805476		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17805476, 18771604, 19125190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18771604	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31615303		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10424404, 22245095, 25546612, 25898135, 26497551, 29250484, 29852388, 31637425		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22363530, 33145341	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	20723265, 37569852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11335099, 17726464, 22363530, 26464709	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17464101, 23266770, 23829397		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11335099, 15069714, 15810071, 15965645, 23973991, 25225353, 25798051, 26718209, 37204028	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31615303		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12609072, 15750928, 19212831, 27829290, 30703157		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36291587	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20090101	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26910913		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26916005		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31809712		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	12925009		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16368648, 20090101, 23929391		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16368648, 20090101, 23929391		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	15257553		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24027047		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	23852020	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	23852020	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31689455		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25880332		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25798051		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24146856	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35185383	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26916005, 27072698		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15742415, 17164780, 17464101	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12960108, 31683810		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15742415, 28347227, 31796117, 34208855, 34476575, 35658213, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22152070	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of pancreas	Pancreatic hypoplasia	BEFREE	29272356		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15951537, 24146856, 29312281, 29556615		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20587550, 29556615	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24146856	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31557250	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	1711433		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19342676		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29414031		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26167512, 33542414	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18429934, 26167512, 33542414, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30670477		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	23472144	Associate	★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	15951537		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22512921		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	26910913		★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	21075170	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15637761	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20300187	Associate	★☆☆☆☆ Found in Text Mining only
Familial encephalopathy with neuroserpin inclusion bodies	Encephalopathy With Neuroserpin Inclusion Bodies	BEFREE	26733586		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	11756233, 26910913		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	15082718	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25973087	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	20300187	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	23035116, 25027323, 29402077	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	25027323		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26108672	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26108996		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26108996	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26108996		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26108996		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26108996	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40234584	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	17082602		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35486633	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28352659		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33613444	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	15951537, 24146856		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20615631		★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	29493066		★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	BEFREE	1711433		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15620698	Stimulate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24146856, 29312281		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24146856	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	15951537		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	22803570		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	22803570	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16630554		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16911935, 24027047, 25798051, 25841765, 25955691, 26493996, 26718209, 27072698, 28841673, 30529751		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25798051		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24027047, 25841765		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21489244, 23374247, 31970893	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	24816397		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	24816397		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20352117, 24816397, 30860673		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	24816397		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27599983	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12200383, 15827139		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30417470		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30946360	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31727394		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20615631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10424404, 22245095, 25546612, 25898135, 29250484, 29852388, 31637425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25841765, 29852388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12609072, 15750928, 19212831, 27829290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26916005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19724918		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23829397, 28706421, 28819380		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31615303		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12499260, 17464101, 19724918, 22245095, 22911792, 23671277, 23829397, 24077352, 25898135, 26493996, 26718209, 26872972, 26916005, 27072698, 27183126, 28561043, 28882998, 30351001, 30981878		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16368648, 20090101, 23929391		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26916005, 27072698		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17545519		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25546612		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14500642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	1711433, 26916005		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	36303457	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	29414031		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27342749		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21992474	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12200383, 19654406, 24077352, 26916005, 27072698, 28506771		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12200383, 20977755	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32640422	Stimulate	★☆☆☆☆ Found in Text Mining only
Myoclonic Epilepsy Juvenile	Myoclonic epilepsy	Pubtator	26945068	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	14695312	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28216622	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	21992474	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10553037, 10896173, 12499260, 12609072, 16368648, 16911935, 1711433, 18331622, 19654406, 22245095, 23208072, 23266770, 23829397, 24027047, 25546612, 27959508, 28000571, 28801701, 28882998, 29432736, 29852388, 30703157, 31637425		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12925009		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24511009, 30930968		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24986468	Stimulate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	30414263	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34142171	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23208072, 29432736, 30719181, 30816440		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30816440	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26916005		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19724918		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19724918		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19724918		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29368272		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29024008		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	29024008		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27046189	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria cutanea tarda	Pubtator	34476575	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18340425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36452480	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Protein C Deficiency	Protein C Deficiency	BEFREE	8639775		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34449539	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37833927	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19342676		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	2924290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	12960108		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31018807		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26464709	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17726464		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20090101, 26318431, 30930968		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29507700		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17726464, 20497865, 26318431, 35610596	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	30414263		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17464101, 23829397, 28706421, 28819380		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15962384, 17464101, 28706421, 37156452	Associate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	23050522, 26975546, 27328415, 28545044		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	40004202	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15951537, 24146856, 29312281, 30351001		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36291587, 37433010	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20090101, 23929391, 37400149	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	36890149	Associate	★☆☆☆☆ Found in Text Mining only