Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	7178
Gene name	Tumor protein, translationally-controlled 1
Gene symbol	TPT1
Synonyms (NCBI Gene)	HRFTCTPp02p23
Chromosome	13
Chromosome location	13q14.13
Summary	This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5`-TOP) in its 5` untranslated region that functions to repress its translation under quiescent cond

254

Show/Hide all (254)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031462	hsa-miR-16-5p	Proteomics	18668040
MIRT052061	hsa-let-7b-5p	CLASH	23622248
MIRT048923	hsa-miR-92a-3p	CLASH	23622248
MIRT048923	hsa-miR-92a-3p	CLASH	23622248
MIRT048369	hsa-miR-29b-3p	CLASH	23622248
MIRT040607	hsa-miR-92b-3p	CLASH	23622248
MIRT039903	hsa-miR-615-3p	CLASH	23622248
MIRT036803	hsa-miR-374b-5p	CLASH	23622248
MIRT052823	hsa-miR-3200-3p	CLASH	23622248
MIRT445426	hsa-miR-100-3p	PAR-CLIP	22291592
MIRT445424	hsa-miR-3614-5p	PAR-CLIP	22291592
MIRT445423	hsa-miR-6500-3p	PAR-CLIP	22291592
MIRT445422	hsa-miR-5008-5p	PAR-CLIP	22291592
MIRT445421	hsa-miR-6089	PAR-CLIP	22291592
MIRT445419	hsa-miR-6765-5p	PAR-CLIP	22291592
MIRT445418	hsa-miR-1304-5p	PAR-CLIP	22291592
MIRT496305	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT496304	hsa-miR-3142	PAR-CLIP	22291592
MIRT496303	hsa-miR-6840-3p	PAR-CLIP	22291592
MIRT496302	hsa-miR-1915-3p	PAR-CLIP	22291592
MIRT496301	hsa-miR-6764-5p	PAR-CLIP	22291592
MIRT496300	hsa-miR-4726-3p	PAR-CLIP	22291592
MIRT496299	hsa-miR-6887-3p	PAR-CLIP	22291592
MIRT496298	hsa-miR-6795-3p	PAR-CLIP	22291592
MIRT496297	hsa-miR-6069	PAR-CLIP	22291592
MIRT496296	hsa-miR-6826-3p	PAR-CLIP	22291592
MIRT445426	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445424	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT445423	hsa-miR-6500-3p	PAR-CLIP	22100165
MIRT445422	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT445421	hsa-miR-6089	PAR-CLIP	22100165
MIRT445419	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT445418	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT445426	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445424	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT445423	hsa-miR-6500-3p	PAR-CLIP	22100165
MIRT445422	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT445421	hsa-miR-6089	PAR-CLIP	22100165
MIRT445420	hsa-miR-3926	PAR-CLIP	22100165
MIRT445419	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT445418	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT439397	hsa-miR-544a	HITS-CLIP	24374217
MIRT726242	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT726241	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT439397	hsa-miR-544a	HITS-CLIP	24374217
MIRT445426	hsa-miR-100-3p	PAR-CLIP	22291592
MIRT445424	hsa-miR-3614-5p	PAR-CLIP	22291592
MIRT445423	hsa-miR-6500-3p	PAR-CLIP	22291592
MIRT445422	hsa-miR-5008-5p	PAR-CLIP	22291592
MIRT445421	hsa-miR-6089	PAR-CLIP	22291592
MIRT445419	hsa-miR-6765-5p	PAR-CLIP	22291592
MIRT445418	hsa-miR-1304-5p	PAR-CLIP	22291592
MIRT496305	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT496304	hsa-miR-3142	PAR-CLIP	22291592
MIRT496303	hsa-miR-6840-3p	PAR-CLIP	22291592
MIRT496302	hsa-miR-1915-3p	PAR-CLIP	22291592
MIRT496301	hsa-miR-6764-5p	PAR-CLIP	22291592
MIRT496300	hsa-miR-4726-3p	PAR-CLIP	22291592
MIRT496299	hsa-miR-6887-3p	PAR-CLIP	22291592
MIRT496298	hsa-miR-6795-3p	PAR-CLIP	22291592
MIRT496297	hsa-miR-6069	PAR-CLIP	22291592
MIRT496296	hsa-miR-6826-3p	PAR-CLIP	22291592
MIRT445426	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445424	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT445423	hsa-miR-6500-3p	PAR-CLIP	22100165
MIRT445422	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT445421	hsa-miR-6089	PAR-CLIP	22100165
MIRT445419	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT445418	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT445426	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445424	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT445423	hsa-miR-6500-3p	PAR-CLIP	22100165
MIRT445422	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT445421	hsa-miR-6089	PAR-CLIP	22100165
MIRT445420	hsa-miR-3926	PAR-CLIP	22100165
MIRT445419	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT445418	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT756039	hsa-miR-145-5p	Luciferase reporter assayWestern blottingqRT-PCR	35371310
MIRT1450441	hsa-miR-1255a	CLIP-seq
MIRT1450442	hsa-miR-1255b	CLIP-seq
MIRT1450443	hsa-miR-125a-3p	CLIP-seq
MIRT1450444	hsa-miR-1272	CLIP-seq
MIRT1450445	hsa-miR-1322	CLIP-seq
MIRT1450446	hsa-miR-147	CLIP-seq
MIRT1450447	hsa-miR-1910	CLIP-seq
MIRT1450448	hsa-miR-298	CLIP-seq
MIRT1450449	hsa-miR-302f	CLIP-seq
MIRT1450450	hsa-miR-3064-3p	CLIP-seq
MIRT1450451	hsa-miR-3145-5p	CLIP-seq
MIRT1450452	hsa-miR-3670	CLIP-seq
MIRT1450453	hsa-miR-3691-5p	CLIP-seq
MIRT1450454	hsa-miR-3911	CLIP-seq
MIRT1450455	hsa-miR-3913-3p	CLIP-seq
MIRT1450456	hsa-miR-455-3p	CLIP-seq
MIRT1450457	hsa-miR-4676-5p	CLIP-seq
MIRT1450458	hsa-miR-4694-5p	CLIP-seq
MIRT1450459	hsa-miR-4709-3p	CLIP-seq
MIRT1450460	hsa-miR-4715-3p	CLIP-seq
MIRT1450461	hsa-miR-4752	CLIP-seq
MIRT1450462	hsa-miR-4786-3p	CLIP-seq
MIRT1450463	hsa-miR-489	CLIP-seq
MIRT1450464	hsa-miR-511	CLIP-seq
MIRT1450465	hsa-miR-548ac	CLIP-seq
MIRT1450466	hsa-miR-548ae	CLIP-seq
MIRT1450467	hsa-miR-548aj	CLIP-seq
MIRT1450468	hsa-miR-548am	CLIP-seq
MIRT1450469	hsa-miR-548d-3p	CLIP-seq
MIRT1450470	hsa-miR-548x	CLIP-seq
MIRT1450471	hsa-miR-548z	CLIP-seq
MIRT1450472	hsa-miR-552	CLIP-seq
MIRT1450473	hsa-miR-575	CLIP-seq
MIRT1450474	hsa-miR-644	CLIP-seq
MIRT1450441	hsa-miR-1255a	CLIP-seq
MIRT1450442	hsa-miR-1255b	CLIP-seq
MIRT1450444	hsa-miR-1272	CLIP-seq
MIRT1450445	hsa-miR-1322	CLIP-seq
MIRT1450446	hsa-miR-147	CLIP-seq
MIRT1450448	hsa-miR-298	CLIP-seq
MIRT1450453	hsa-miR-3691-5p	CLIP-seq
MIRT1450454	hsa-miR-3911	CLIP-seq
MIRT1555182	hsa-miR-4307	CLIP-seq
MIRT1450457	hsa-miR-4676-5p	CLIP-seq
MIRT1450458	hsa-miR-4694-5p	CLIP-seq
MIRT1555183	hsa-miR-4714-3p	CLIP-seq
MIRT1450461	hsa-miR-4752	CLIP-seq
MIRT1450462	hsa-miR-4786-3p	CLIP-seq
MIRT1450473	hsa-miR-575	CLIP-seq
MIRT1450474	hsa-miR-644	CLIP-seq
MIRT1450441	hsa-miR-1255a	CLIP-seq
MIRT1450442	hsa-miR-1255b	CLIP-seq
MIRT1450443	hsa-miR-125a-3p	CLIP-seq
MIRT1450444	hsa-miR-1272	CLIP-seq
MIRT2134655	hsa-miR-128	CLIP-seq
MIRT1450445	hsa-miR-1322	CLIP-seq
MIRT1450446	hsa-miR-147	CLIP-seq
MIRT1450447	hsa-miR-1910	CLIP-seq
MIRT2134656	hsa-miR-27a	CLIP-seq
MIRT2134657	hsa-miR-27b	CLIP-seq
MIRT1450448	hsa-miR-298	CLIP-seq
MIRT1450451	hsa-miR-3145-5p	CLIP-seq
MIRT1450453	hsa-miR-3691-5p	CLIP-seq
MIRT1450454	hsa-miR-3911	CLIP-seq
MIRT1450455	hsa-miR-3913-3p	CLIP-seq
MIRT1555182	hsa-miR-4307	CLIP-seq
MIRT1450456	hsa-miR-455-3p	CLIP-seq
MIRT1450457	hsa-miR-4676-5p	CLIP-seq
MIRT1450458	hsa-miR-4694-5p	CLIP-seq
MIRT2134658	hsa-miR-4698	CLIP-seq
MIRT1450461	hsa-miR-4752	CLIP-seq
MIRT1450462	hsa-miR-4786-3p	CLIP-seq
MIRT1450463	hsa-miR-489	CLIP-seq
MIRT1450464	hsa-miR-511	CLIP-seq
MIRT1450465	hsa-miR-548ac	CLIP-seq
MIRT1450466	hsa-miR-548ae	CLIP-seq
MIRT1450467	hsa-miR-548aj	CLIP-seq
MIRT1450468	hsa-miR-548am	CLIP-seq
MIRT1450469	hsa-miR-548d-3p	CLIP-seq
MIRT1450470	hsa-miR-548x	CLIP-seq
MIRT1450471	hsa-miR-548z	CLIP-seq
MIRT1450472	hsa-miR-552	CLIP-seq
MIRT1450473	hsa-miR-575	CLIP-seq
MIRT1450474	hsa-miR-644	CLIP-seq
MIRT1450441	hsa-miR-1255a	CLIP-seq
MIRT1450442	hsa-miR-1255b	CLIP-seq
MIRT1450444	hsa-miR-1272	CLIP-seq
MIRT2134655	hsa-miR-128	CLIP-seq
MIRT1450445	hsa-miR-1322	CLIP-seq
MIRT1450446	hsa-miR-147	CLIP-seq
MIRT1450447	hsa-miR-1910	CLIP-seq
MIRT2134656	hsa-miR-27a	CLIP-seq
MIRT2134657	hsa-miR-27b	CLIP-seq
MIRT1450448	hsa-miR-298	CLIP-seq
MIRT1450451	hsa-miR-3145-5p	CLIP-seq
MIRT2355962	hsa-miR-3646	CLIP-seq
MIRT1450452	hsa-miR-3670	CLIP-seq
MIRT1450453	hsa-miR-3691-5p	CLIP-seq
MIRT1450454	hsa-miR-3911	CLIP-seq
MIRT1450455	hsa-miR-3913-3p	CLIP-seq
MIRT1555182	hsa-miR-4307	CLIP-seq
MIRT1450456	hsa-miR-455-3p	CLIP-seq
MIRT1450457	hsa-miR-4676-5p	CLIP-seq
MIRT1450458	hsa-miR-4694-5p	CLIP-seq
MIRT2134658	hsa-miR-4698	CLIP-seq
MIRT1450459	hsa-miR-4709-3p	CLIP-seq
MIRT1450461	hsa-miR-4752	CLIP-seq
MIRT1450462	hsa-miR-4786-3p	CLIP-seq
MIRT1450463	hsa-miR-489	CLIP-seq
MIRT1450464	hsa-miR-511	CLIP-seq
MIRT1450465	hsa-miR-548ac	CLIP-seq
MIRT1450466	hsa-miR-548ae	CLIP-seq
MIRT1450467	hsa-miR-548aj	CLIP-seq
MIRT1450468	hsa-miR-548am	CLIP-seq
MIRT1450469	hsa-miR-548d-3p	CLIP-seq
MIRT1450470	hsa-miR-548x	CLIP-seq
MIRT1450471	hsa-miR-548z	CLIP-seq
MIRT1450473	hsa-miR-575	CLIP-seq
MIRT1450474	hsa-miR-644	CLIP-seq
MIRT1450443	hsa-miR-125a-3p	CLIP-seq
MIRT1450447	hsa-miR-1910	CLIP-seq
MIRT1450455	hsa-miR-3913-3p	CLIP-seq
MIRT1450456	hsa-miR-455-3p	CLIP-seq
MIRT1450463	hsa-miR-489	CLIP-seq
MIRT1450464	hsa-miR-511	CLIP-seq
MIRT1450472	hsa-miR-552	CLIP-seq
MIRT1450441	hsa-miR-1255a	CLIP-seq
MIRT1450442	hsa-miR-1255b	CLIP-seq
MIRT2134655	hsa-miR-128	CLIP-seq
MIRT1450446	hsa-miR-147	CLIP-seq
MIRT1450447	hsa-miR-1910	CLIP-seq
MIRT2134656	hsa-miR-27a	CLIP-seq
MIRT2134657	hsa-miR-27b	CLIP-seq
MIRT1450451	hsa-miR-3145-5p	CLIP-seq
MIRT1450453	hsa-miR-3691-5p	CLIP-seq
MIRT1450454	hsa-miR-3911	CLIP-seq
MIRT1450455	hsa-miR-3913-3p	CLIP-seq
MIRT1555182	hsa-miR-4307	CLIP-seq
MIRT1450456	hsa-miR-455-3p	CLIP-seq
MIRT1450458	hsa-miR-4694-5p	CLIP-seq
MIRT1450461	hsa-miR-4752	CLIP-seq
MIRT1450463	hsa-miR-489	CLIP-seq
MIRT1450464	hsa-miR-511	CLIP-seq
MIRT1450465	hsa-miR-548ac	CLIP-seq
MIRT1450466	hsa-miR-548ae	CLIP-seq
MIRT1450467	hsa-miR-548aj	CLIP-seq
MIRT1450468	hsa-miR-548am	CLIP-seq
MIRT1450469	hsa-miR-548d-3p	CLIP-seq
MIRT1450470	hsa-miR-548x	CLIP-seq
MIRT1450471	hsa-miR-548z	CLIP-seq
MIRT1450474	hsa-miR-644	CLIP-seq
MIRT1450441	hsa-miR-1255a	CLIP-seq
MIRT1450442	hsa-miR-1255b	CLIP-seq
MIRT2134655	hsa-miR-128	CLIP-seq
MIRT1450446	hsa-miR-147	CLIP-seq
MIRT1450447	hsa-miR-1910	CLIP-seq
MIRT2134656	hsa-miR-27a	CLIP-seq
MIRT2134657	hsa-miR-27b	CLIP-seq
MIRT1450451	hsa-miR-3145-5p	CLIP-seq
MIRT1450453	hsa-miR-3691-5p	CLIP-seq
MIRT1450454	hsa-miR-3911	CLIP-seq
MIRT1450455	hsa-miR-3913-3p	CLIP-seq
MIRT1555182	hsa-miR-4307	CLIP-seq
MIRT1450456	hsa-miR-455-3p	CLIP-seq
MIRT1450458	hsa-miR-4694-5p	CLIP-seq
MIRT1450461	hsa-miR-4752	CLIP-seq
MIRT1450463	hsa-miR-489	CLIP-seq
MIRT1450464	hsa-miR-511	CLIP-seq
MIRT1450465	hsa-miR-548ac	CLIP-seq
MIRT1450466	hsa-miR-548ae	CLIP-seq
MIRT1450467	hsa-miR-548aj	CLIP-seq
MIRT1450468	hsa-miR-548am	CLIP-seq
MIRT1450469	hsa-miR-548d-3p	CLIP-seq
MIRT1450470	hsa-miR-548x	CLIP-seq
MIRT1450471	hsa-miR-548z	CLIP-seq
MIRT1450474	hsa-miR-644	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
VDR	Activation	19815065

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IDA	15162379
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	15162379, 15958728
GO:0005515	Function	Protein binding	IPI	16730713, 17301792, 18325344, 21081126, 21278788, 22451927, 25277244, 25416956, 27607350
GO:0005615	Component	Extracellular space	IDA	15319436
GO:0005615	Component	Extracellular space	TAS	7542803
GO:0005634	Component	Nucleus	IDA	11598139
GO:0005654	Component	Nucleoplasm	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15162379
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005771	Component	Multivesicular body	IDA	15319436
GO:0005829	Component	Cytosol	IDA
GO:0005881	Component	Cytoplasmic microtubule	IDA	15162379
GO:0006816	Process	Calcium ion transport	IC	15958728
GO:0006874	Process	Intracellular calcium ion homeostasis	IC	15958728
GO:0009615	Process	Response to virus	IEP	16548883
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0042981	Process	Regulation of apoptotic process	NAS	15162379
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	11598139
GO:2000384	Process	Negative regulation of ectoderm development	IEA

MIM	HGNC	e!Ensembl
600763	12022	ENSG00000133112

P13693

Protein name

Translationally-controlled tumor protein (TCTP) (Fortilin) (Histamine-releasing factor) (HRF) (p23)

Protein function

Involved in calcium binding and microtubule stabilization (PubMed:12167714, PubMed:15162379, PubMed:15958728). Acts as a negative regulator of TSC22D1-mediated apoptosis, via interaction with and destabilization of TSC22D1 protein (PubMed:183253

PDB

1YZ1 , 2HR9 , 3EBM , 4Z9V , 5O9L , 5O9M , 6IZB , 6IZE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00838	TCTP	1 → 168	Translationally controlled tumour protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in several healthy and tumoral cells including erythrocytes, hepatocytes, macrophages, platelets, keratinocytes, erythroleukemia cells, gliomas, melanomas, hepatoblastomas, and lymphomas. It cannot be detected in kidney and renal

Sequence

MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGE
GTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAE
QIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC

Sequence length

172

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (124)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	19621893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23256924, 27880046, 30881019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	25241147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28939212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	12487227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17645945, 28219065, 31779161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	36714975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28939212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34626801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30805558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11598139, 20847343, 22074947, 22677230, 23165143, 24106833, 25779659, 30893896, 31052313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17127214, 25779659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26425551, 32792860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14621192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34498708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24761856, 28970113, 29254214, 30881019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35534983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26425551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25564355, 30941821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	38025678	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	19479337, 29867020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22677230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29113234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	11444477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30066095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	12872291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10880768, 22340241, 28143584, 30066846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	28143584	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28143584, 30066846, 30563768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23203071, 28143584, 32248186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29113234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	32792860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31320615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26425551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	19157425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28134765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental reading disorder	Developmental dyslexia	BEFREE	19277710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25363345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	11598139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28134765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12579533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25564355, 30941821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12377406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14621192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	9032265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	3313005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	21983636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	14621192, 21983636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28506239, 31481102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	22468085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30029885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30029885, 31681570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23749504, 26328748, 27764782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24311645, 26328748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34626801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31320615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	29436669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	25363345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27816562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17976639, 29867020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	16178871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24657995, 28939212, 29676587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	12872291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	28536478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Isodicentric Chromosome 15 Syndrome	Isodicentric Chromosome 15 Syndrome	BEFREE	12673638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	22853445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis Herpetic	Herpetic keratitis	Pubtator	22853445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	28321044		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12149273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12034535, 8500100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19116456	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21081126, 24761856, 32046740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24067374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32156253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34498708	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	25363345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30201713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11598139, 20847343, 22074947, 22677230, 23165143, 24106833, 25779659, 30893896, 31052313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28506239, 31481102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	28321044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18630514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24761856, 28128835, 28472637, 28970113, 29254214, 30881019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24165482, 28928875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12377406, 19360337, 22899854, 23894469, 25241147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18630514, 19364479, 21565400, 22157679, 23165143, 23355466, 24067374, 25936523, 26425551, 26972431, 27813490, 28472637, 28846114, 28958626, 29216544 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10880768, 22340241, 28143584, 30066846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16809759, 20847343, 25779659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29130935		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28751755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10880768, 10953283, 12377406, 15489264, 15949565, 16809759, 19621893, 21565400, 22074947, 22157679, 24106833, 24165482, 24311645, 24657995, 25092287 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	16178871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16178871	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	16178871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18797883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26318737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21691801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	25092287, 30381327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25522670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18325344, 23042265, 32156253, 34224310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24165482, 28928875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32792860, 35534983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14621192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29471019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	20012759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31460785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38243290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	30370446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12377406, 19360337, 22899854, 23894469, 25241147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17549383		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24657995, 28939212, 29676587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26425551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23900261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18345488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12872291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	12872291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	22468085, 32156253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25363345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	21983636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14621192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	14621192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	30201713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28846114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TPT1 (tumor protein, translationally-controlled 1)